SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6XNR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6XNR0
Domain Number 1 Region: 6-74
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000969
Family Calponin-homology domain, CH-domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6XNR0
Sequence length 239
Comment (tr|F6XNR0|F6XNR0_XENTR) Sperm flagellar 1 {ECO:0000313|Ensembl:ENSXETP00000060310} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN= OC=Silurana.
Sequence
MAVEFDEETLQELYSWVDRIPLSRPKRNIARDFSDGVLTAELVKFYFPKIVEMHNYVPAN
STTQKFSNWNILNRKVLSKLSFSVPDDVIRKIVQCSPGVVELVLNTLRQKIEEKQRVNQI
SAEFSQEQAPQNTTNIHSDKATAQNSAQDQVPRPIQQDKCNTGHNTTPGIKTHQGYAQAA
NADTALRFQLAEKEQALILSQETIQQILQAKLRRMEQLLQLKNVRIDDLTRRLQELEKK
Download sequence
Identical sequences F6XNR0
ENSXETP00000060310 ENSXETP00000060310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]