SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6XQ64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6XQ64
Domain Number 1 Region: 1-154
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.45e-27
Family GDI-like N domain 0.000000497
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6XQ64
Sequence length 155
Comment (tr|F6XQ64|F6XQ64_MACMU) Rab GDP dissociation inhibitor {ECO:0000256|RuleBase:RU363124} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=GDI2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MNEEYDVIVLGTGLTLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEV
TRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPR
TFEGIDPKKTTMREVYKKFDLGQDVIDFTGHALAL
Download sequence
Identical sequences F6XQ64
ENSMMUP00000036351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]