SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6XTP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6XTP6
Domain Number 1 Region: 311-524
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.09e-59
Family DBL homology domain (DH-domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 507-668
Classification Level Classification E-value
Superfamily PH domain-like 2.26e-34
Family Pleckstrin-homology domain (PH domain) 0.0026
Further Details:      
 
Domain Number 3 Region: 691-852
Classification Level Classification E-value
Superfamily PH domain-like 1.16e-22
Family Pleckstrin-homology domain (PH domain) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6XTP6
Sequence length 880
Comment (tr|F6XTP6|F6XTP6_CANLF) FYVE, RhoGEF and PH domain containing 4 {ECO:0000313|Ensembl:ENSCAFP00000015594} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=FGD4 OC=Canis.
Sequence
MIIKRVKPNISLSKQVRLIISICEVMSTDQGSSICPKITIVPPYVKNSRTPLVDQNVSNE
EAQGINGKTPAKHSAASPKPQVPPKPLYLRNSPSSKIHQTPRHKALSSAEPRMEKEVKPA
SASCVSKEKPSKVSDLISRFEGGSTLSTYSDLKKDSGVNLNVPRTPGRHGLTTTPQRKLV
SQQPPQKQENDTDPTQGVQTDVANGVMAAQNQMECEEDKVVTVSPETPVQTSEPLLAVNL
VNGEGEEEATTRPATPTANDYDGNASDSSCRTPRVSQVLPPEEGRADMEAKVQEQEDGES
PLEPEQLDQHPEMKETNEEKLHKIANELLLTERAYVNRLDLLDQVFYCKLLEEANRGSFQ
AEMVNKIFSNISSINAFHSKFLLPELEKRMQEWETTPRIGDILQKLAPFLKMYGEYVKGF
DNAMELVKNMTERIPQFKAVVEEIQKQKICGSLTLQHHMLEPVQRIPRYEMLLKDYLRKL
PPDSPDWNDAKKSLEIISTAASHSNSAIRKMENLKKLLEIYEMLGEEEDIVNPSNELIKE
GQILKLAARNTSAQERYLFLFNNMLLYCVPRFSLVGSKFTVRTRVGIDGMKIVETHNEEY
PHTFQVSGKERTLELQASSEQDKEEWIKALQETIDAFHQRHETFRNAIAKDNDMHSEVST
AELGKRAPRWIRDNEVTMCMKCKESFNALTRRRHHCRACGHVVCWKCSDYKAQLEYDGGK
LNKVCKDCYQIISGFTDSEEKKRKGILEIESAEVSGNSIVCSFLQYMEKSKPWQKAWCVI
PKQDPLVLYMYGAPQDVRAQATIPLLGYVVDDMPRSADLPHSFKLTQSKSVHSFAADSEE
LKQKWLKIIFLAVTGETPDGPNKHPATLDDHPESKKKSEC
Download sequence
Identical sequences F6XTP6
ENSCAFP00000015594 XP_003433606.1.84170 ENSCAFP00000015594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]