SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6XVR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6XVR6
Domain Number 1 Region: 388-622
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.37e-38
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 
Domain Number 2 Region: 85-241,387-437
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.88e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.066
Further Details:      
 
Domain Number 3 Region: 994-1027
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000371
Family LIM domain 0.01
Further Details:      
 
Domain Number 4 Region: 1028-1057
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000884
Family LIM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6XVR6
Sequence length 1124
Comment (tr|F6XVR6|F6XVR6_MACMU) Microtubule associated monooxygenase, calponin and LIM domain containing 2 {ECO:0000313|Ensembl:ENSMMUP00000036976} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=MICAL2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MGENEDEKQAQAGQVFENFVQASTCKGTLQAFNILTRHLDLDPLDHRNFYSKLKSKVTTW
KAKALWYKLDKRGSHKEYKRGKSCMNTKCLIVGGGPCGLRTAIELAYLGAKVVVVEKRDT
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILFKVALMLGVEIHVN
VEFVKVLEPPEDQENQKIGWRAEFLPADHSLSEFEFDVIIGADGRRNTLEGFRRKEFRGK
LAIAITANFINRNSTAEAKVEEISGVAFIFNQKFFQDLKEETGIDLENIVYYKDCTHYFV
MTAKKQSLLDKGVIINDYIDTEMLLCAENVNQDNLLSYAREAADFATNYQLPSLDFAMNH
YGQPDVAMFDFTCMYASENAALVRERQAHQLLVALVGDSLLEPFWPMGTGCARGFLAAFD
TAWMVKNWNQGTPPLELLAERESLYRLLPQTTPENINKNFEQYTLDPGTRYPNLNSHCVR
PHQVKHLYITKELEHYPLERLGSVRRSVNLSRRESDIRPSKLLTWCQQQTEGYQHVNVTD
LTTSWRSGLALCAIIHRFRPELINFDSLNEDDAVENNQLAFDVAEREFGIPPVTTGREMV
SAQEPDELSMVMYLSKFYELFRGTPLRPVDSWRKNYGENADLSLAKSSISNNYLNLTFPR
KRTPRVDGQIGENDMNKRRRKGFNNLDEPSNFSSRSVGSNQECGSSKEGGNQNKVKSMAN
QLLAKFEESTRNPSLMKQERCVSGIGKPVLCSSSGPPVHSCCLKLEEATPSPSPPLKRQF
PSVVVTGHVLRELKQVSAGSECLSRPWRARAKSDLQLGGTENFATLPSTRPRAQALSGVL
WRLQQVEEKILQKRAQNLANREFHTKNIKEKAAHLASMFGHGDFPQNKLLSKGLSHTHPP
SPPSCLPSPDPAASSSPSTIDSASPARKEKKSPSGFHFHPSHLRTVRPQLTVGKVSSGIG
AAAEVLVNLYMNDHRPKAQATSPDLESMRKSFPLNLGGSDTCYFCKKRVYVMERLSAEGH
FFHRECFRCSVCATTLRLAAYTFDCDEGKFYCKPHFIHCKTNSKQRKRRAELKQQREEEA
TWQEQEAPLRDTPTESSCAVAAIGTLEGSAPVHFSLPVLHPLLG
Download sequence
Identical sequences F6XVR6
XP_014970333.1.72884 XP_014970335.1.72884 ENSMMUP00000027574 ENSMMUP00000027573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]