SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6XXR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6XXR7
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.19e-29
Family Frizzled cysteine-rich domain 0.00013
Further Details:      
 
Domain Number 2 Region: 120-230
Classification Level Classification E-value
Superfamily TIMP-like 0.0000000000000013
Family Netrin-like domain (NTR/C345C module) 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6XXR7
Sequence length 243
Comment (tr|F6XXR7|F6XXR7_HORSE) Secreted frizzled related protein 2 {ECO:0000313|Ensembl:ENSECAP00000014669} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=SFRP2 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
GIEYPEQRLFNLLGHEIMKEVLEHGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQ
PCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVC
EACKNKNEDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDL
KKSVLWLKDSLQCTCEEMNDINAPYLVMGQKVGGELVITSVKRWQKGQREFKRISRSIRK
LQC
Download sequence
Identical sequences F6XXR7
ENSECAP00000014669 9796.ENSECAP00000014669 ENSECAP00000014669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]