SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6XXZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6XXZ6
Domain Number 1 Region: 1-68
Classification Level Classification E-value
Superfamily E set domains 0.00000000000382
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.048
Further Details:      
 
Weak hits

Sequence:  F6XXZ6
Domain Number - Region: 74-122
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0161
Family HLH, helix-loop-helix DNA-binding domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6XXZ6
Sequence length 264
Comment (tr|F6XXZ6|F6XXZ6_CALJA) Early B-cell factor 2 {ECO:0000313|Ensembl:ENSCJAP00000037067} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=EBF2 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGA
PGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLAKEMLLKRAADLVEALYGTPHNNQD
IILKRAADIAEALYSVPRNPSQLPALSSSPAHSGMMGINSYGSQLGVSISESTQGNNQGY
IRNTSSISPRGYSSSSTPQQSNYSTSSNSMNGYSNVPMANLGVPGSPGFLNGSPTGSPYG
TGLWLTWLLRAFWEKKRIETIPFL
Download sequence
Identical sequences F6XXZ6
ENSCJAP00000037067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]