SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6Y040 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6Y040
Domain Number 1 Region: 2078-2291
Classification Level Classification E-value
Superfamily SET domain 8.24e-65
Family Histone lysine methyltransferases 0.00041
Further Details:      
 
Domain Number 2 Region: 2452-2564
Classification Level Classification E-value
Superfamily Bromodomain 4.84e-22
Family Bromodomain 0.0015
Further Details:      
 
Domain Number 3 Region: 2584-2648
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000128
Family PHD domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6Y040
Sequence length 2977
Comment (tr|F6Y040|F6Y040_MONDO) Histone-lysine N-methyltransferase {ECO:0000256|SAAS:SAAS00591749} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=ASH1L OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MDHRNTAMLGVGSDSEGFSRKSPSAINTGTLVSKREVELENSTKEEEDLWRRNRDRNIET
GKNDGLTDAQQQFSVKETNFSEGNLKLKIGLQAKRTKKPPKNLENYVCRPAIKTSIKHPR
KALKSGKMTDEKNEHCPSKRDPSKLYKKASDVAAVESRSEEGIHLHSQGENNPVSKKLSP
LHSEMTDYVKSAPSTLIGSRDPDSKDRALLNGATSVTEKLAQLIATCPPSKSSKTKPKKL
GAGITAGLVSKDLIRKPGIGPMAGIIHKDLVKKPTISTAVGLVTKDPGKKPIFSAAVGLV
SKDSGKKLGAGTTTVFINKDLGKKPGTITTVGLVSRDSGKKLGIGIVPGLVSKESGKKLG
LGTVVGLVNKDSVKKLGPTIGLVAKDCGKKTIANSVVGLVSKDPAKKLVACPVAGLVSKD
IVNLKAEALLPAQEPLKVSCNTNTNSHESQELSESLKDSATSKAFEKTIIRQNKDSILEK
FSIRKEIISLDKDIFNEGTCIQQDSFLSSERGTYVETTKHEKQPPVYCTSPDFQMGGNSD
ASTARSPFSAVGEGNLPSPSPALSVTPLNRSPPGTSSQLAPNPLHLGPSTELIEGIAESI
GKAQFSSENSHMNLGHRSLIHSMNTDCKGSDKELSDSKAIHTDNPRMGPSIGKKPSLASE
SSIHATITPSVVSFTSLFSSKPFLKIGAVTASEKHCQVAESLSTSLQSKPLKKRKGRKPR
WTKVVARSTCRPPKGLELERSELFKNVSCSSLSSSNSEPSKFMKNIGPSSFVEHDFLKCR
LPKLSKSSTTPSLALLTETDKQSHKSFATHKLSSSICMSGDLLPDIYKPKRGRPKTKEMP
QLEGPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQSLSVSPFPKKRGRPKRQI
RSPVKMKPPVLSVAPFVATESPNKLESESDKHRSSSDFFERKDQLQGPDDSHKPSVCGMS
DLEMEPDKKINKRNNGQLMKTIIRKINKMKTLKRKKLLNQILSSSVESSNKGKVQSKLHN
TVSTLAATFGSKLGQQINVSKKGTIYIGKRRGRKPKAVLNGILTSSPTGLAVLEKTAHQA
AGSALGQLLPPLLPSAANSSEVLPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPYLHIHS
RQGSMIQTLAMKKASKGRRRLSPPTLLPNSPSHLSELTSLKEATPSPISESHSDETIPSD
SGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRSHDYL
SYDKMKRQKRKRKKKYPQLRNRQDPDFLADLEELISRLSEIRITHRSHHFIPRDLLPTIF
RINFNSFYTHPTFPLDPLHYIRKPDLKKKRGRPPKMREAMAEMPFMHSLSFPLSSTGFYP
SYGMPYSPSPLAAAPIGLGYYGRYPPTLYPPPPSPSFTTPLPPPSYMHAGHLLLNPAKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMAYGWMVEHKHRHRHKHREHRTSEQPQV
SMDTLATNSSSRTVLESLKRYRFGKDAVGERYKHKEKHRCHMSCPHLSPSKNLLSREEQW
VHREPSESSSLALGLQTPLQIDCSETSPGLSLGGFTPSSEPASSDEHTNLFTSAIGSCRV
SNSTNTSSRKKLTDSPGLFTAQDTSLNRPLRKETLPSNERALQTLTGSQPALDKPSQRPS
ESTNCSPTRKRSSSESTSSTGNVIGIPTRGTRLGTSVDDSVDSLLQRMAQHESHGTLEKN
IDAVIATVSIPPSSSPGHTHNRERVLGKSDSLLVPATPSDSCSNTTISLLSERLPSSCSP
HHLKRSVVEAMQRQARKMCNYDKILATKKNLDHVNKILKAKKLQRQARTGNNFVKRRPGR
PRKYPLQAVVSMQAFQAAQFASPELDEGEEGGALHLGPDTVTDVIEAVVQSVNLNPELRK
GWKRKSWLLEEEARKRQKILPEEEQENNKSFPETTVESPSPPEAPPKPSEPENALQPLPS
LIPREKKVPRPPKKKYQKAGLYSDVYKTTDPKSRLIQLKKEKLEYTPGEHEYGLFPAPIH
VVHDAYVSGKYLRQKRIDFQLPYDILWQWKHNQLYKKPDVPLYKKIRSNVYVDVKPLSGY
EATTCNCKKPDDGNRKGCMDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFR
AEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDS
YRMGNEARFINHSCNPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQ
LCKCGFDKCRGIIGGKSQRMNGLTSKSSQPVTTHRRPGRSKEKRKSKHKLKKRRGHFSEE
PNENVNTPTRMTPQLQMKPMSNRERNFVLKHHVFLVRNWEKIRQKQEEVKHTSDNIHSAS
LYTRWNGICRDDGNIKSDVFMTQFSALQTARSVRTRRLAAAEENIEVARAARLAQIFKEI
CDSIISYKDSSRQALAAPLLNLPPKKKNADYYEKISDPLDLITIEKQILTGYYKTVEAFD
ADMLKVFRNAEKYYGRKSPIGRDVCRLRKAYYNARHEASAQIDEIVGETASEADSSETSV
CEKENGHEKDDDVIRCICGLYKDEGLMIQCDKCMVWQHCDCMGVNSDVEHYLCEQCDPRP
VDREVPMIPRPHYAQPGCVYFICLLRDDLLLRQGDCVYLMRDSRRTPDGHPVRQSYRLLS
HINREKLDIFRIEKLWKNEKEERFAFGHHYFRPHETHHSPSRRFYHNELFRVPLYEIIPL
EAVVGTCCVLDLYTYCKGKPKGVKEQDVYICDYRLDKSAHLFYKIHRNRYPVCTKPYAFD
HFPKKLTPKRDFSPHYVPDNYKRNGGRSSWKTERSKPPIKDLGQEDDALPLIEEVLASQE
QATSEMPTLEEPDREVASGETPEGEKKVDEGGQEPQRSCTPEERRHNQRERLNQILLNLL
EKIPGKNAIDVTYLLEEGSGRKLRRRTLLIPESSFRK
Download sequence
Identical sequences F6Y040
13616.ENSMODP00000021257 ENSMODP00000021257 ENSMODP00000021257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]