SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6Y4N0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6Y4N0
Domain Number 1 Region: 57-139
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000887
Family Eukaryotic type KH-domain (KH-domain type I) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6Y4N0
Sequence length 896
Comment (tr|F6Y4N0|F6Y4N0_MACMU) NEDD4 binding protein 1 {ECO:0000313|Ensembl:ENSMMUP00000024966} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=N4BP1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MAARAVLDEFTAPAEKAELLEQSRGRIEGLFGVNLAVLGALGAEEPLPARIWLQLCGAQE
AVHSAKEYIKGICEPELEERECYPKDMHCIFVGAESLFLKSLIQDTCADLCILDIGLLGI
RGSAEAVVMARSHIQQFVKLFENKENLPSSQKESEVKREFKQFVEAHADNYTMDLLILPT
SLKKELLTLTQGEENLFETGDDDVIEIRDSQQTEFTQNAATGLNISRDESVLQEEARNKA
GTPVSELTKQMDTVLSSSPDVLFDPINGLTPDEEALSNERICQKRRFSDSEERHTKKQFS
LENVQEGEILHDAKTLAGNVIADLSDSSTDSENLSPDIKETTEEMEYNILVNFFKTMGYS
QEIVEKVIKVYGPSSEPLLLLEEIEKENKRFQEDREFSAGTMYPETNKTKNKGVYSSTNE
LTTDSTPKKTQTHAQQNMAEKFSQLPFKVEAKPCTSNCRINTFRTVPVEQKHEVWGSNQN
YVCNIDPETDGLSPSVASSSPKEVNFVSRGASSHQPRVPVFPENGLHQQPEPLLPNNMKS
ACEKRLGCCSSPHSKPNCSTLSPPMPLPQLLPSVTDARSAGPSDHIDSSVTGVQRFRDTL
KVPYKLELKNEPGRTDLKHIVIDGSNVAITHGLKKFFSCRGIAIAVEYFWKLGNRNITVF
VPQWRTRRDPNVTEQHFLTQLQELGILSLTPARMVFGERIASHDDRFLLHLADKTGGIIV
TNDNFREFVNESVSWREIITKRLLQYTFVGDIFMVPDDPLGRSGPRLEEFLQKEVCLRDM
QPLLSALPNVGMFDPSFRVPGTQAASTSHQPPTRIQGAPSSHWLPQQPHFPLLPALPNLQ
QNLPMPAQRSSAETNELREALLKIFPDSEQRLKIDQILVAHPYMKDLNALSAMVLD
Download sequence
Identical sequences F6Y4N0
9544.ENSMMUP00000024966 ENSMMUP00000024966 ENSMMUP00000024966 XP_001109863.2.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]