SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6Y5Q8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6Y5Q8
Domain Number 1 Region: 723-980
Classification Level Classification E-value
Superfamily RNI-like 9.32e-51
Family 28-residue LRR 0.0000909
Further Details:      
 
Domain Number 2 Region: 1-89
Classification Level Classification E-value
Superfamily DEATH domain 1.88e-21
Family Pyrin domain, PYD 0.0003
Further Details:      
 
Domain Number 3 Region: 1375-1460
Classification Level Classification E-value
Superfamily DEATH domain 6.59e-16
Family Caspase recruitment domain, CARD 0.023
Further Details:      
 
Domain Number 4 Region: 327-417,452-500
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000204
Family Nucleotide and nucleoside kinases 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6Y5Q8
Sequence length 1473
Comment (tr|F6Y5Q8|F6Y5Q8_CANLF) NLR family pyrin domain containing 1 {ECO:0000313|Ensembl:ENSCAFP00000022816} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=NLRP1 OC=Canis.
Sequence
MACRVQWQLAWYLEMMGKEELKEFQLRLLEQQFWGDPPHALRAQLGKARGLEVASRLVAQ
YGEQQAWVLALRTWEEMGLSRLCAQSRAEAGLIPLSPGSPMAPSMQSPNSPISTEVLRFI
QDPRTRNSGQPLPPLLPNTSGHMWNEDPSSCKYQEGLPDSPEFQGSPHQESPSAPMPTAV
LGGWEAPPQPSPVPGKQEAPKAGWPVAGTSGNHNPEKEGREGGRKGRRREEARKGGSPTQ
PRAGRQPQVQPEGHPWPGPRGRKKPYPTWSWEDKDLHQIFIQLLLLHQPYPRGHESLTKG
RWHHGAEKQGHLIEVEDLFGPGLGAQEEPQTVILHGVAGIGKSTLARQIRTAWKEGQLYK
DRFRHVFYFNCRELARSETMSLTELITKAQAGPVLPAEQILSQPGRLLFILDDLDEPRWV
LGEQESELHSSWSKQRPVHALLGSLLGKTVLPEVSLLVTVRTTALRRLVPSVGQLCWVEV
LGFSESGRREYFYKYFKNKSQATQAFSLVELNPTLLTMCLVPLVSWLLCTCLKKQMQRGE
ELSLGSSQTTTALWLYYLSQALPAQLLGAQLRGFCSLAAEGFWQGTNLLSRRDLRKHGFD
EATISTFLKTGILRKHPSPLNYHLAHRCLQEFFAAVSCVLGGEDGGSPHPDSIRGAEKLL
EVYEGHDLFGAPTTHFLFGLLSEQGEREMEAVFQCKLPRERKRDLLRWAEAGLWPRLSAP
QPCSLHLLHCLYEIQDEDLLTRAMAHFHGRSMCVQTGVEFLVCTFCFKFCSHVKRLQLNE
SRWDGQAWRPSSVALFSWVPVTDACWQALFSTLRASGSLKELDLSGNHLSHPAVQSLCKV
LKFPCCHLETVRLAGCGLTAEGCSDLASALSASPALAELELSFNLLLDAGAQHLSRGLRQ
PACRLRRLLLAGCSLTSRCCGALASALSTSPLLTELDLQQNELGDVGVRLLCGGLGHPTC
QLTLLWLDQTQLSEEMTQMLRALQEEKPQLFVCSKWKPRATVPTEGLSRGETSGTSSLKQ
QRQGSGDQKLPDRESGADSCSAPFPERSCPQVGQVQLGRPPSPAAPWDLNTEPLRIGDGF
WGPLGPVAPEWLAEDGSLYRVHLPVAGSYHWPDTGLRFEVRGPATIDIEFCVWDQHLPRA
GLWHSWMVAGPLFDIKAEPGAVATVCLPHFVDLQGSSVDTSLFYAAHLKDEGMLVETPAR
VEADHVVLENPSFSPIGVLLRTIHAALRFLPVTSVVLLYHHLRPGEVAFHLYLIPSDYSI
RKAIDNEEKKFQFVQIHKPPPLASLYMGSRYTVSGSEKLEIIPKELELCYRSPREPQLFS
EFYVSHLGSGIRLQVRDKKDDTVVWEALVKPGDLRPVASLAPPAPAARPFPTDAPAWLHF
VDRHREQLVARVTSVDPVLDMLHGQVLSEEQYERVRAEATTPSQMRKLFSFSRSWDRACK
DQVYQALKEAHPHLIMELWEKWGGNSGKQAPPG
Download sequence
Identical sequences F6Y5Q8
ENSCAFP00000022816 ENSCAFP00000022816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]