SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6YBF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6YBF1
Domain Number 1 Region: 242-342
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.1e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000649
Further Details:      
 
Domain Number 2 Region: 93-145
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000367
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.047
Further Details:      
 
Domain Number 3 Region: 15-70
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000707
Family HLH, helix-loop-helix DNA-binding domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6YBF1
Sequence length 670
Comment (tr|F6YBF1|F6YBF1_CALJA) Hypoxia inducible factor 3 alpha subunit {ECO:0000313|Ensembl:ENSCJAP00000022122} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=HIF3A OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MALGLQRARSATELRKEKSRDAARSRRSQETEVLYQLAHTLPFARGVSAHLDKASIMRLT
ISYLRMHRLCASGEWNQVGAGGEPLDACYLKALEGFVMVLTAEGDMAYLSENVSKHLGLS
QLELIGHSIFDFIHPCDQEELQDALTPQQTLSRRKAEAPPTERCFSLRMKSTLTSRGRTL
NLKAATWKVLHCSGHMRAYKPPAQTSPAGSPSSEPPLQCLVLICEAIPHPGSLEPPLGRG
AFLSRHSLDMKFTYCDDRIAEVAGYSPDDLIGCSAYEYIHALDFDAVSKSIHTLLSKGQA
VTGQYRFLARSGGYLWTQTQATVVSGGRGSQSESIICVHFLISRVEETGVVLSLEQTEQH
SRRPIQRGSPSQKDASNSGGSLDAPGPRILAFLHPPSMSEAALAADPRRFCSPDLRRLLG
PILDGASVAATPSTPPATRRPRSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDVA
QDADALDLEMLAPYISMDDDFQLNASEQLPRAYHRPLGAVPRPRAQSFHGLSPPAFEPSL
LPRWGSDPRLSCSSPSRGNPSASSLMAGARKRTLAQSSEGEDEGVELLGVRPPKRCPSPE
PGNFLLFPLSLSFLLTGGPAPGSLQDPSTPLLDLNEPLGLGPSLLSPYSDGDTDQPRGHF
QPAAGSGQAD
Download sequence
Identical sequences F6YBF1
ENSCJAP00000022122 ENSCJAP00000022122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]