SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6YG64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6YG64
Domain Number 1 Region: 464-649
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.06e-47
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 329-420
Classification Level Classification E-value
Superfamily WWE domain 0.0000000000000327
Family WWE domain 0.0038
Further Details:      
 
Weak hits

Sequence:  F6YG64
Domain Number - Region: 238-262
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00973
Family CCCH zinc finger 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6YG64
Sequence length 657
Comment (tr|F6YG64|F6YG64_MACMU) TCDD inducible poly(ADP-ribose) polymerase {ECO:0000313|Ensembl:ENSMMUP00000000485} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_11970 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MEMETTEPEPDCVVQPPSPPDNFSCQMRLSEKITPLKTCFKKKDQKRLGTGTLRSLRPIL
NTLLESGSLDGVFRSRNQSTDENSLHEPMMKKAMEINSSCPPAENNMSVLIPDRTNVGDQ
IPEAHPSTEAPEQVVPIQDHSFPSETLSGTVADSTAGHFQTDLLHPVSSDVPTSPDCLDK
VIDYVPGIFQENSFTIQYILDTSDKLSTELFQDKSEEASLDLVFELVNQLQYHTHQENGI
EICMDFLQGTCIYGRDCLKHHTVLPYHWQIKRTTTQKWQSVFNDSQEHLERFYCNPENDR
MRMKYGGQEFWADLNAMNVYETTEFDQLRRLSTPPSSNVNSIYHTVWKFFCRDHFGWREY
PESVIRLIEEANSRGLKEVRFMMWNNHYILHNSFFRREIKRRPLFRSCFILLPYLQTLGG
VPTQAPPPLEATSSSQIICPDGVTSANFYPETWVYMHPSQDFIQVPVSAEDKSYRIIYNL
FHKTVPEFKYRILQILRVQNQFLWEKYKRKKEYMNRKMFGRDRIINERHLFHGTSQDVVD
GICKHNFDPRVCGKHATMFGQGSYFAKKASYSHNFSKKSSKGVHFMFLAKVLTGRYTMGS
HGMRRPPPVNPGSVTSDLYDSCVDNFFEPQIFVIFNDDQSYPYFVIQYEEVSNTVSI
Download sequence
Identical sequences A0A096NAY2 A0A2K5LHN0 A0A2K6AE55 A0A2K6R5T1 F6YG64 G7NZK0
ENSMMUP00000038623 ENSPANP00000009888 XP_005546238.1.63531 XP_010364206.1.97406 XP_011853432.1.47321 XP_011853433.1.47321 XP_011942047.1.92194 XP_014987350.1.72884 XP_014987351.1.72884 XP_014987352.1.72884 XP_014987353.1.72884 XP_015300714.1.63531 9544.ENSMMUP00000038623 ENSMMUP00000000485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]