SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6YG67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6YG67
Domain Number 1 Region: 36-128
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 6.41e-38
Family SCAN domain 0.0000431
Further Details:      
 
Domain Number 2 Region: 472-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 585-642
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 435-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-18
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 631-683
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-18
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 6 Region: 514-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000318
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 213-268
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000915
Family KRAB domain (Kruppel-associated box) 0.0061
Further Details:      
 
Domain Number 8 Region: 376-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000001
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6YG67
Sequence length 685
Comment (tr|F6YG67|F6YG67_HORSE) Zinc finger protein 263 {ECO:0000313|Ensembl:ENSECAP00000021756} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=ZNF263 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
LTMASGPGSQEREGLLIVKLEEDCVWSQELPPPDPGPSPEASHLRFRRFRFQEAAGPREA
LSRLQELCHGWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVED
MQRELERPRQQVTNRGRGTEVLLEEPLPLETARESPSFKLEPMETERSPGPRLQELLGPS
PKRDPQAVKERALAASWLSLFPPEGNMEDKEMTGPQLPESLEDVAMYISQEWGHQDPSKR
ALSRDTVQDSYENVDSLESQVPSQEALSTQVEQAGKPWYPSVQTCKEGLSPRSPAPGEEK
FENREESAQSVSSESLHPQVLLPGQARGDVPWSPEQGRLQDRAEGPWEPPPEDQMEQSLL
GTISCRELGRPKELQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCMGVECGEIFGGT
PHFLSLHRARLGEEAHKCLECGKSFSQNTHLTRHQRTHTGEKPYQCNICGKSFSCNSNLH
RHQRTHTGEKPYKCSECGEIFAHSSNLLRHQRIHTGERPYKCAECGKSFSRSSHLVIHER
THEKERLYPFSECGEAMSDSTLFLTNHGTHKAEKKLFECLTCGKSFRQGMHLTRHQRTHT
GEKPYKCTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERP
YKCSECGESFSRSSRLMSHQRTHTG
Download sequence
Identical sequences F6YG67
9796.ENSECAP00000021756 ENSECAP00000021756 ENSECAP00000021756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]