SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6YJ26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6YJ26
Domain Number 1 Region: 375-560
Classification Level Classification E-value
Superfamily NTF2-like 8.77e-64
Family NTF2-like 0.0000000439
Further Details:      
 
Domain Number 2 Region: 114-205
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.41e-35
Family Non-canonical RBD domain 0.0000162
Further Details:      
 
Domain Number 3 Region: 209-364
Classification Level Classification E-value
Superfamily L domain-like 2.35e-32
Family mRNA export factor tap 0.000000295
Further Details:      
 
Domain Number 4 Region: 557-624
Classification Level Classification E-value
Superfamily UBA-like 7.14e-25
Family TAP-C domain-like 0.0000775
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6YJ26
Sequence length 625
Comment (tr|F6YJ26|F6YJ26_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000010059} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=NXF1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
LCLGSLFFTPEHDDRVGGSFPQRRKKGRGPFRWKYGETNSRPRNRGGPGPRAAHPAEEDG
DVAMSDAQDGPRARYTPYNSRPNRRGGDNWHDRDRIHVTVRRDRAGQDRGATAGGSLDAV
PKNWFRITIPYGRKYDKTWLLNSLQSKCSVPFTPVEFHYENTRAQFFVEDASTAMAIKAV
NHKIVDRENRRITVIINPSAPPQSVLNELKPEQVEQLKFVMSKRYDGSQQALDLKGLRTD
PDLVAQNIDVVLNRRNCMSASLRIIEENIPELLSLNLSNNRLYRLDDLSDIVQKAPNLKI
LNLSGNELKSERELDKVKGLKLDELWLMGNPLCAAFRDQSFYISAIRERFPKLLRLDGHE
LPPPIAFDVEAPTTLPPCKGSYFGSENLKAMVLYFLQQYYSVYDSGDRQGLLDAYHDQAC
CSLSIPFTSQNPARGSMSEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHD
VNSFVVDICAQTETLLCFAVHGVFKEVDGKSRDSVRAFSRVFIAVPSNNAARLCIVNDKL
FIRNATTDEIRRAFVMPAPTPSSSPVPTLSPEQQEMLQTFSTQSGMNLEWSQKCLQDNDW
DFARAAHVFTQLKAGSKIPEVAFLK
Download sequence
Identical sequences F6YJ26
ENSMODP00000010059 ENSMODP00000010059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]