SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6YLN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6YLN9
Domain Number 1 Region: 728-908
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.67e-48
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.018
Further Details:      
 
Domain Number 2 Region: 582-685
Classification Level Classification E-value
Superfamily WWE domain 0.00000000000000837
Family WWE domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6YLN9
Sequence length 919
Comment (tr|F6YLN9|F6YLN9_XENTR) Poly(ADP-ribose) polymerase family member 12 {ECO:0000313|Ensembl:ENSXETP00000019558} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=parp12 OC=Silurana.
Sequence
MSDPRVSSYLTSLLCNHEGRLRRSQLGDLLQLPPEQIEQILQEEPHRFSVSGDLVLARTA
MRICPDYLKQKEEEKECDKLHLCRLYLQGKCWAARGRGNNSKGLVHVICAKVSTLREKKK
LNSIVVPTSKFLKLPDSPLGWPQVCIKYLHSTCDRENGCTRLHVCGYFTRGECNRTNCRR
SHCLLESSTDLVMKQSRHSLVSIENFQMLCVIKCNEAVNVPKKGANNGAQCGPSGAGRGR
GRGRDWRGPRRGSRSSSTPGSRCSTPDKLDAEDDEDGVFDPPSGDKEEKSAAASGPSSSV
GSTEWSSAPQPKPRILSLNRNASSESSTQEANSSRERHKATGSISKGQGANSAIISPNNH
IPTGTATGTTSVEQKVNSTTTNPGMYPTTGTTSVAQKVNSTTPQLPHLPATGAASMEQKV
NSTTTNPAMYPTTRTTSVAQKVNSTIYPPTRNTSMEQKKVNSTTTNPAMYPTTRTTSVAQ
KVNSAAIGKYAATGTTSEVNSTTTTGPGNGGSLSEICLHHIWKHCRLGNKCGEMHYHLPY
RWQENLGAGWQDFSHMDAIERAFCQPKNDSYSGVDFASMTYGPIRIRRLATPSSATRSLE
FVLTTEWLWYWQDELGTWIEYGKCNTKQVGASITSSDLESIYLADKTAVVPFQAGGQHYE
ISFKDMIQRNIKYTTQRRIRRRPKYQSSEDVQKLKGTPTRKPATYRDFLISGKFTPQGKT
KPLPCRDYYLVPVRESSHEYTQILGLFNKTMSGQTVKIQRIQNKSLWEVYQWQKVQMQKA
NPGKGVSEMQLFHGTDPSHRAAICHQNFDWRVCGTNGTVYGQGSYFARDASYSHNYSVPT
ATGRRMMFVARVLVGDYVRGDPTMKRPPLRPGSATQCYDSCVDTFYNPSIFVVFEKHQIY
PEYLLEYEPKKEEKSCCIS
Download sequence
Identical sequences F6YLN9
ENSXETP00000019558 ENSXETP00000019558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]