SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6YLV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6YLV0
Domain Number 1 Region: 17-73
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000772
Family HLH, helix-loop-helix DNA-binding domain 0.0042
Further Details:      
 
Weak hits

Sequence:  F6YLV0
Domain Number - Region: 83-120
Classification Level Classification E-value
Superfamily Orange domain-like 0.000432
Family Hairy Orange domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6YLV0
Sequence length 151
Comment (tr|F6YLV0|F6YLV0_CALJA) Hes family bHLH transcription factor 5 {ECO:0000313|Ensembl:ENSCJAP00000004630} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=HES5 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKAD
ILEMAVSYLKHSKGGVPSMGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFK
EPKAPGVAPPPSAKATAAAARQPACGLWRPW
Download sequence
Identical sequences F6YLV0
ENSCJAP00000004630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]