SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6YP00 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6YP00
Domain Number 1 Region: 398-508
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-24
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 221-332
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.09e-19
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 
Domain Number 3 Region: 515-580
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000104
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 574-636
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000514
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 5 Region: 47-164
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000536
Family Spermadhesin, CUB domain 0.0058
Further Details:      
 
Domain Number 6 Region: 642-701
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000865
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 7 Region: 162-223
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000001
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 8 Region: 337-401
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000364
Family Complement control module/SCR domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6YP00
Sequence length 794
Comment (tr|F6YP00|F6YP00_HORSE) Seizure related 6 homolog like {ECO:0000313|Ensembl:ENSECAP00000021202} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=SEZ6L OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MAQEAPPEDASPMTLMDKGENDLTGSASEETTTSTIITTTVITTEQAPALCSVSFSDPEG
YIDSGDYPPLPLSNFLECTYNVTVYTGYGVELQVKSVNLSEGELLSIRGVDGPTLTVLAN
QTLLVEGQVIRSPTNTISVYFRTFQDDGLGTFQLHYQAFMLSCNFPRRPDYGDVTVMDLH
SGGVAHFHCHLGYELQGAKTLTCINASKPHWSSQEPICSAPCGGAVHNATIGRVLSPSHP
GNTNGGQFCVWTIEAPEGQKLHLHFERLSLHEKDRMMVYSGLTNKSALLYDSLQIESVPF
EGLLSEGNSIRIEFTSDQPQVASAFNIRFEAFEKGHCYEPYIQNGNFTTSDPTYNIGTTV
EFTCDPGHSLEQGPAVIECINVRDPYWNDTEPLCRAMCGGELSAVAGVVLSPNWPEPYVE
GEDCIWKIHVGEEKRIFLDIQFLNLSNSDILTIYDGDEVMPHILGQYLGNSGPQKLYSST
PDLTIQFHSDPAGLIFGKGQGFIMNYIEVSRNDSCSDLPEIQNGWKTTSHTELVRGARIT
YQCDPGYDIVGSDTLTCQWDLSWSSDPPFCEKIMYCTDPGEVDHSTRLISDPVLLVGTTI
QYTCNPGFVLEGSSLLTCYSRETGTPIWTSRLPHCVSEESLACDNPGLPENGYQILYKRL
YLPGESLTFMCYEGFELMGEVTIRCILGQPSHWNGPLPVCKVNQDSFEHALEVAEAAAET
SLEGGNMALAIFIPVLIISLLLGGAYIYITRCRYYSNLRLPLMYSHPYSQITVETEFDNP
IYETGETREYEVSI
Download sequence
Identical sequences F6YP00
9796.ENSECAP00000021202 ENSECAP00000021202 ENSECAP00000021202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]