SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6YPQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6YPQ2
Domain Number 1 Region: 339-529
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 1.05e-79
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.000000122
Further Details:      
 
Domain Number 2 Region: 12-104
Classification Level Classification E-value
Superfamily A heparin-binding domain 6.8e-42
Family A heparin-binding domain 0.00000551
Further Details:      
 
Domain Number 3 Region: 105-170
Classification Level Classification E-value
Superfamily Amyloid beta a4 protein copper binding domain (domain 2) 4.05e-28
Family Amyloid beta a4 protein copper binding domain (domain 2) 0.0000627
Further Details:      
 
Domain Number 4 Region: 270-329
Classification Level Classification E-value
Superfamily BPTI-like 1.56e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6YPQ2
Sequence length 716
Comment (tr|F6YPQ2|F6YPQ2_HORSE) Amyloid beta precursor like protein 2 {ECO:0000313|Ensembl:ENSECAP00000019678} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=APLP2 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
ALAANAGTGFAVAEPQIAMFCGKLNMHVNIQTGKWEPDPTGTKSCFGTKEEVLQYCQEMY
PELQITNVMEANQPVSVDNWCRRDRKQCRSHIVIPFKCLVGEFVSDVLLVPEKCQFFHKE
RMEVCENHQHWHAVVKEACLTQGMTLYSYGMLLPCGVDQFHGTEYVCCPQTKIIESTVSK
EDEEDEEEEEGEDEEEDYDIYKSEFPTEADLEDFTEAAVDVDDEDEEEGEEVVEDRDYYY
DTFKGDDYNEENPTERSSDGTISEKEITHDVKAVCSQEAMTGPCRAVMPRWYFDLSKGKC
VRFIYGGCGGNRNNFESEDYCMAVCKTMIPPTPLPTNDVDVYFETSADDNEHARFQKAKE
QLEIRHRNRMDRVKKEWEEAELQAKNLPKAERQTLIQHFQAMVKALEKEAASEKQQLVET
HLARVEAMLNDRRRMALENYLAALQSDPPRPHRILQALRRYVRAENKDRLHTIRHYQHVL
AVDPEKAAQMKSQVMTHLHVIEERRNQSLSLLYKVPYVAQEIQEEIDELLQEQRADMDQF
TASLSETPVDVRVSSEESDEIPPFRPFHPFPSLPGDEGSGVGEQDRALIGAEEKVINSKN
KVDENMAIDETLDVKEMIFNAERVGGLEEEPESVGPLREDFSLSSSALIGLLVIAVAIAT
VIVISLVVLRKRQYGTISHGIVEVDPMLTPEERHLNKMQNHGYENPTYKYLEQMQI
Download sequence
Identical sequences F6YPQ2
ENSECAP00000019678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]