SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6YRF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6YRF3
Domain Number 1 Region: 1-229
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.24e-67
Family BAR domain 0.00053
Further Details:      
 
Domain Number 2 Region: 221-253,284-341
Classification Level Classification E-value
Superfamily SH3-domain 1.23e-17
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6YRF3
Sequence length 342
Comment (tr|F6YRF3|F6YRF3_HORSE) SH3 domain containing GRB2 like, endophilin B1 {ECO:0000313|Ensembl:ENSECAP00000007417} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=SH3GLB1 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
QFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPNARIEEFVYEKL
DRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNF
LTPLRNFIEGDYKTISKERKLLQNKRLDLDAAKTRLKKAKAAETRASSEQELRITQSEFD
RQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSNYHCNN
NQTSVAPMPSASSNVIGSSALTSTSGLVIASPSNLVDLKECSGSRKARVLYDYDAANSSE
LSLLADEVITVFSVVGMDSDWLMGERGNQKGRVPITYLELLN
Download sequence
Identical sequences F6YRF3
ENSECAP00000007417 9796.ENSECAP00000007417 ENSECAP00000007417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]