SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6YRR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6YRR6
Domain Number 1 Region: 100-285
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-48
Family SPRY domain 0.0000576
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6YRR6
Sequence length 287
Comment (tr|F6YRR6|F6YRR6_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000001247} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
SNYSRMYAFLRRKEEQHLLRLGKKKQKNLEKFKENKWKLSEQVQDLQTMAIKLDINNAEK
LDFNMIQDAKDMLNKSKALLLQYPKLNLPKWTMCYITGLREMKMTYQRDIKLDPETANSH
LIVSSELKSIKYSLVPQDVPDNPERFNFSATVLSIQSFTSGIHYWEVETGDMIQWEVEIC
KNSINRKGNSPPIPGEVISLKAFKEREKFCLSVTHIEANFQIKKPIQRIDPFLDYENGHI
SFYNVTDGLLICSMSVIAFKGPFRSFFSPCFQNKGSPSKSLVICPME
Download sequence
Identical sequences F6YRR6
13616.ENSMODP00000001247 ENSMODP00000001247 ENSMODP00000001247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]