SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6YU49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6YU49
Domain Number 1 Region: 86-214
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-27
Family Ran-binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6YU49
Sequence length 217
Comment (tr|F6YU49|F6YU49_CALJA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCJAP00000046093} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=NUP50 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
VEVAAEKKTDPSLGATSASFNFGKKVDSSVVGSLSSVPLTGFSFSPGNSSLLGKDITQSK
PVSSPFPAKPLEGQVEGDSSECKGGDEEESDEPPKVVVTEVKEDDAFYSKKCKLFYKKDN
EFKEKGIGTLHLKPTVNQKTQLLVRADTNLGNILLNVLIPPNMPCTRTGKNNVLIVCVPN
PPIDEKNATVPVTMLIRVKTSEDAEELHKILLEKRDA
Download sequence
Identical sequences F6YU49
ENSCJAP00000046093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]