SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6YUJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6YUJ6
Domain Number 1 Region: 234-378
Classification Level Classification E-value
Superfamily PH domain-like 4.61e-44
Family Third domain of FERM 0.00045
Further Details:      
 
Domain Number 2 Region: 133-236
Classification Level Classification E-value
Superfamily Second domain of FERM 4.84e-27
Family Second domain of FERM 0.00011
Further Details:      
 
Domain Number 3 Region: 53-133
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.92e-21
Family First domain of FERM 0.0016
Further Details:      
 
Domain Number 4 Region: 533-603
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.41e-16
Family DBL homology domain (DH-domain) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6YUJ6
Sequence length 604
Comment (tr|F6YUJ6|F6YUJ6_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000020026} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MGEIEGTYRVLETPGSRLGGPNHTGISTLEPGQSLSSAMVKTSAKLQEKDLPIKVRLLDN
TTEILHVEPKCYGQILLTEVFKHLNLIESDYFGLEFQNVQSYWIWLEPTKPIIKQVQRPR
STLLRLAVKFFPPDPGQLQEEYTRYLFALQIKRDLVEERMPCSDSTAALLTSHLLQMLVG
DYEEVTDREHLKTNKYVPHQDRIQERILENHQKHVGQTPAESDFQVLEIARKLEMYGIRF
HLASDREGTKINLAVSHMGVLVFQGNTKINTFNWSKVRKLSFKRKRFLIKLHPEVHGPHQ
DTLEFLLGSRDECKNFWKICVEYHTFFRLLDQPKPKAKAVFFSRGSSFRYSGRTQRQLVD
YVKDSGMKKTPYERRHSKARIASRPLSKDGPKQSISYTEGSRLPGSPCSSDASFHPGPAA
DLPPCMDSSRAFVASKAPLAERSSGPSAEEAEQKAGPPGGSPLLQSFQGLSEDSSQHSNL
TSSKSSLNLPPSFQVALSPTGRGSSPLLSPVLGDAGCVQVEEEEETRPKRVPTDKAYFMA
KEILATEWTYLKDLEVITVWFRSAVIKEEAMPGPLMALLFSNIDPIYEFHRGFLKEMEQR
LALW
Download sequence
Identical sequences F6YUJ6
ENSMODP00000020026 13616.ENSMODP00000020026 ENSMODP00000020026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]