SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6YV70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6YV70
Domain Number 1 Region: 6-167
Classification Level Classification E-value
Superfamily E set domains 1.96e-55
Family RhoGDI-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6YV70
Sequence length 171
Comment (tr|F6YV70|F6YV70_HORSE) Unc-119 lipid binding chaperone B {ECO:0000313|Ensembl:ENSECAP00000019662} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=UNC119B OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
SDYLCKPEDNVYSIDFTRFKIRDLETGTVLFEIAKPYVSDQEEEEEEEGGDVDISAGRFV
RYQFTPAFLRLRTVGATVEFTVGDKPVSNFRMIERHYFRERLLKNFDFDFGFCIPSSRNT
CEHIYEFPQLSEDVIRLMIENPYETRSDSFYFVDNKLIMHNKADYAYNGGQ
Download sequence
Identical sequences F6YV70
ENSECAP00000019662 ENSECAP00000019662 9796.ENSECAP00000019662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]