SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6YV89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6YV89
Domain Number 1 Region: 215-445
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 7.72e-17
Family Soluble quinoprotein glucose dehydrogenase 0.0026
Further Details:      
 
Weak hits

Sequence:  F6YV89
Domain Number - Region: 638-670
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000134
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6YV89
Sequence length 700
Comment (tr|F6YV89|F6YV89_HORSE) Hedgehog interacting protein {ECO:0000313|Ensembl:ENSECAP00000021977} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=HHIP OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MLKMLSFKLLLLAVALGFFEGDAKFGERSEGSGARRRRCLNGNPPKRLKRRDRRMMSQLE
LLSGGEMLCGAFYPRLSCCLRSDSPGLGRLDNKIFSVTNNTECGKLLEEIKCALCSPHSQ
SLFHSPEREALERDLELPLLCKDYCKEFFYTCRGHIPGFLQTTADEFCFYYARKDGGLCF
PDFPRKQIRGPASNYLDQMEEYDKVEEMSRKHKHNCFCIQEVVSGLRQPVSALHSGDGSH
RLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLY
VSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHRKHLGGQLLFG
PDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCSVPYSIPRSNPHFNSTSQ
PPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSL
LEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVSKQWQEKPLCLGNS
GSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVQP
AQTLTSECSRLCRNGYCTPTGKCCCSPGWEGDFCRIAKCEPACRHGGVCVRPNKCLCKKG
YLGPQCEQVDRNIRRVTRAGILDQIIDMTSYLLDLTSYIV
Download sequence
Identical sequences F6YV89
9796.ENSECAP00000021977 ENSECAP00000021977 XP_014693598.1.49734 ENSECAP00000021977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]