SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6YX78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6YX78
Domain Number 1 Region: 6-212
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.64e-45
Family DBL homology domain (DH-domain) 0.00021
Further Details:      
 
Domain Number 2 Region: 200-331
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000268
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6YX78
Sequence length 333
Comment (tr|F6YX78|F6YX78_MONDO) Rho guanine nucleotide exchange factor 39 {ECO:0000313|Ensembl:ENSMODP00000009309} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=ARHGEF39 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MGSPGPRCPVSEQRARWERKRGRTARELLETERRYQEQLALVVQYFLCILRAKGTLRPAE
LLAVFGPWESIHIASQELLLHLEAGNWGAGLERFCHHLELYTRFAANEEQSRATLQKRLR
KSKHFRRFVQLQEGRPEFGGLRLVDLLPLPLQRLQQYENLVVALAENTGPDSPDYPQLTK
AAQKLSEAIQHVSAISREQENGRQLHRIQTLLSGRRAKGLTKGRWFLRQGWLLVVPPKGE
PKPRMFFLFSDALLMAKPRSVLHVLYGGTFACRALYPMAQCQLQRIFGHSGGAGGGLLSL
SFPQEKLLLMSTNQESLSRWYHSLTLAISSQRR
Download sequence
Identical sequences F6YX78
ENSMODP00000009309 ENSMODP00000009309 XP_007498861.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]