SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6YZK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6YZK0
Domain Number 1 Region: 774-1061
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.52e-68
Family Protein kinases, catalytic subunit 0.0000322
Further Details:      
 
Weak hits

Sequence:  F6YZK0
Domain Number - Region: 130-172
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00272
Family Heme-binding PAS domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6YZK0
Sequence length 1100
Comment (tr|F6YZK0|F6YZK0_CALJA) PAS domain containing serine/threonine kinase {ECO:0000313|Ensembl:ENSCJAP00000051650} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=PASK OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MKKMRQEHRLCCVVVLEPVERVSTWVAFQSDGTVTSCDSLFAHLHGFVSGEDVAGRCITD
LIPSLQLPPGQHIPKNLKIQRSVGRARDGTTFPLSLKLKSEPSSEEVTTSEVAPLRDYWA
SVWVFCTISGLITLLPDGTIHGINHSFALMLFGYGKSELLGKNITFLIPGFYSYMDLAND
SSLQLPDLASCLDVSDKSGCGETTSDPWQGQDPAEGSQDPRINVLAGGHVLPRDEARKLV
GSGDVFTGTQTELGTGGRLPSCLSPQPAPGVDSVAEGSPPAHGEQVLPEDQHTTASGREE
PAAVETPGQGLLGGSRPEPVDAKPSASCEDSEAPGPAEDRGSNTGLCGLYQQAQLELTGV
SGSDLWAGVAVAQPQAKGQLPVGSLPMHCPCYRSEQGLWRRSQDLARSPSGVAGISLGTP
TLDEPWLGVKNDQEELQTCLTKEELSELSLVGALDIPHAELVPAECPAFTAPVLSCDLGG
RDLYSGCTGSSSACYALATDLPRGLEEVQAQEVDVNSFSWNLKELVSRDQTEQTSSNCSC
AMSELGGTPSSSAVCSDPDVGGLQEQGPCILDDRELLLLTGTCVDLGQGRGFLESCLGHD
PTEPSEVCSVSSEHYAASDRGSPGHFPSTLDAGPENTCPSAEETTLDVQVTSTPVMPGAA
GLQREIQEGAYSGSCHHRDGLRLSIRFEVRRVELQGPSPLFCCWLVKDLLHSHRDSAART
CLLLASLPGSTHSTTAELTGPSLGEVLRAKPWFEDAPKAVELEGLAACEGEYSQKYSTLS
RLGSGAFGSVWTAVDKEQNKEVVVKFIKKEKVLEDCWIEDPDLGKVPLEIAILSRVEHAN
IIKVLDVFQNHGFFQLVMEKHGSGLDLFAFIDCHPRLDEPLASYIFRQLVSAVGYLRLKD
IIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPE
LEMWSLGVTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPEKRTTLE
KLVTDPWITQPVNLAEYTWEEVCQVNKPESGVLSTASLEMGSRSLSEVAQAQALCAGPAP
GEAPDGHGCLHPRDPRLLTS
Download sequence
Identical sequences F6YZK0
ENSCJAP00000051650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]