SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6Z0W2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6Z0W2
Domain Number 1 Region: 127-321
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.16e-59
Family Astacin 0.0000904
Further Details:      
 
Domain Number 2 Region: 748-859
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.28e-38
Family Spermadhesin, CUB domain 0.00019
Further Details:      
 
Domain Number 3 Region: 444-546
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-37
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 4 Region: 593-703
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-36
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 5 Region: 328-437
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-35
Family Spermadhesin, CUB domain 0.00082
Further Details:      
 
Domain Number 6 Region: 884-977
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-30
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 7 Region: 548-591
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000249
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 8 Region: 701-745
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000046
Family EGF-type module 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6Z0W2
Sequence length 988
Comment (tr|F6Z0W2|F6Z0W2_HORSE) Metalloendopeptidase {ECO:0000256|RuleBase:RU361183} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=BMP1 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MRGVAHLPLPLPLLLWLLLLARPGRPLDLADYTYELGEEDDSEPLNYKDPCKAVAFLGDI
ALDEEDLRAFQVQQAVDLGQQAIRRSSIKAAENSSTPICQSTSGQPQRKNRGRWRSRSRS
RRAATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVF
TYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDRHVSIVR
ENIQPGQEYNFLKMELQEVESLGENYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPP
IGQRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGE
KIILNFTSMDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGAKLPEPVVSTDSRLWVEFRS
SSNWVGKGFFAVYEAICGGDVKKDNGHIQSPNYPDDYRPSKVCVWRIQVSEGFHVGLTFQ
SFEIERHDSCAYDYLEVRDGHSEGSPLIGRYCGYERPDDIKSTSSRLWLKFVSDGSINKA
GFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKL
NGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTAD
SKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDC
VNTFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPDKYPSKKECTWAIS
STPGHRVKLTFTEMDIESQPECAYDHLEVYDGRDAKADILGRFCGSKKPEPILATGSRMF
LRFYSDNSVQRKGFQASHSTECGGQVQAEVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEE
GYGVELVFQTFEVEEETDCGYDYMELFDGYDSTAPRLGRYCGSGPPEEVYSAGDSVLVKF
HSDDTITKKGFHLRYTSTKFQDTLHSRK
Download sequence
Identical sequences F6Z0W2
9796.ENSECAP00000019709 XP_005607717.1.31192 ENSECAP00000019709 ENSECAP00000019709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]