SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6Z1X6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6Z1X6
Domain Number 1 Region: 516-666
Classification Level Classification E-value
Superfamily EF-hand 1.8e-50
Family Osteonectin 0.00000237
Further Details:      
 
Domain Number 2 Region: 462-513
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000665
Family Ovomucoid domain III-like 0.00066
Further Details:      
 
Domain Number 3 Region: 434-458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000228
Family Follistatin (FS) module N-terminal domain, FS-N 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6Z1X6
Sequence length 667
Comment (tr|F6Z1X6|F6Z1X6_HORSE) SPARC like 1 {ECO:0000313|Ensembl:ENSECAP00000007659} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=SPARCL1 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MKTVLFFLYILGTTAAIPANVRFLSDHSQPTADPLSSVQQAESLVTPDDTTVSIFRVEDS
ENEKETAASTEDHPNHGAEKSSILKSKEENYDQSADQDQSYSQELGLQDQEESESDLSEN
LENSPSKDTLDLKEDISEPQKKKLPENVDFLAPEVSSTADSNQQESITMTEENQEQPVNT
SYPQLNRSSEHSQDLSDPGNQEQDPNTADGEEEEEQETGEVATYNDNQEGGRELPKEHAD
SKQEGENTQSDDILEESNQPTQESKMQKDELEQSNQEQEQNDSKAEVEEETASKINKHNQ
DTEQQSQEGKPGLEFISNHEEMDKKTVSEALLVDPTDDGNTIARKHGADDDGDDGPRHDA
SDDYFIPSEDFLEAERAQSISYHIRYEEERERALENENVDTNEPGEHQEAKTAESSPIED
ESSSEGNMRVHGVDSCLNFQCKRGHICKADRHGKPHCVCQDPVTCPPSKLLDQVCGTDNH
TYASSCHLFATKCRLEGTKKGHQLQLDYFGACKSIPACTDFEVIQFPLRMRDWLKNILMQ
LYEPNPEHAGYLNEKQRNKVKKIYLDEKRLLAGDHSIDLLLRDFKKNYHMYVYPVHWQFS
ELDQHPMDRVLTHSELAPLRASLVPMEHCITRFFDECDPNKDKHITLKEWGHCFGIKEED
IDENLLF
Download sequence
Identical sequences F6Z1X6
ENSECAP00000007659 9796.ENSECAP00000007659 XP_001496069.1.31192 XP_014594218.1.31192 ENSECAP00000007659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]