SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6Z1Z0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6Z1Z0
Domain Number 1 Region: 3671-3813
Classification Level Classification E-value
Superfamily SET domain 5.89e-46
Family Histone lysine methyltransferases 0.0049
Further Details:      
 
Domain Number 2 Region: 1413-1482
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000113
Family PHD domain 0.0069
Further Details:      
 
Domain Number 3 Region: 1511-1579
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000219
Family PHD domain 0.009
Further Details:      
 
Domain Number 4 Region: 1650-1713
Classification Level Classification E-value
Superfamily Bromodomain 0.0000209
Family Bromodomain 0.0053
Further Details:      
 
Weak hits

Sequence:  F6Z1Z0
Domain Number - Region: 1376-1434
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00117
Family PHD domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6Z1Z0
Sequence length 3816
Comment (tr|F6Z1Z0|F6Z1Z0_XENTR) Histone-lysine N-methyltransferase {ECO:0000256|PIRNR:PIRNR010354} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=kmt2a OC=Silurana.
Sequence
MAHSCRWRFPARPGTGRRLGARHRLSAILIDDVSEYRSNPGASGSAGASSAGTLAPGGPG
NCLGVALGFDAALQVSAAIGNNLRRFRDVSGGSSGEEEQFLGFGSDEEVKGRSPAKSPKD
QTTQRKPRGRPRNSLSRCSDASSNLCENTTSTLNKQETRLLDKVKKPESKTEEKKRGRPP
AHGNVKFKLPQEKRDGTESIKAPCEEKSKRRKPSATFQHAAKIKKLRAGKLSPLKSKFKS
NKLKLGRKGGVSIVRRRGRPPSSERFKTDTHGSFPKQVPTDRSQRGNKDVSPQPSKEDTR
VSVRQSPRRMKPVRIIPSSKRTDTAIAKQLLQKAKKGAQKKMELEAAKLQGRKGGTQLKN
IRQFIMPVVSTVSSRIIKTPRRFIEDEDYEPPIKIARLESAPNGSRFSTASCGSSEKSSA
ASQQSSQATSDDSRSSSPSVDTSTESQASEETPVVSEPQGRVAETITSVPTQQQPLESNG
VRTRRLPVCNKNFSSRPAKKIVLRPSFQQKSSVSPPPPLLSPPTPLQPSASLPDHTPWLM
PAIPMATPFISASRMHEKRRSILREPTFRWTSLKHSRLESQYFSSAKYAKEGLIRKPIFD
NFRPPPLTPEDVGLATASGFPSHTVVGPGRLFSHIHSSGARFDVHKRSPLLRAPRFTPSE
AHSRIFESVTLPPSAGRASGTSSMMGISRRSKRRVFNPIRSSEPKSPSHSMRTRSRRVGN
SSLSVLASPPSSSLTDISVSPLATSALNPSFPFSSSSVTPASVDIAEKIQKPRKPTSTPA
EHFTSSPSSSPALFPWFPSSVQMEKGKSKNRGSVESSKEREVEKNREKDREKENSRDSRR
DKRKKSSDSGCKISRERNDEEGIVTATQIKMSVRKKPVTVESNVDISPASIHTDQIPAKN
KISKKGRPVSEKTELDTCAKSPTAETQAQLPAQPVSALKHPSTSISSMLAQADKFPVSDK
HVATLLRKAKAQLCKIEKSKFLKQTDQPKAQGQESDSSEASVRGPRIKHVCRRAAVALGR
KRAVFPDDMPTLSALPWEEREKVLSSMGNDDKSSIAGSEDADQPAPPLKPIKQITRNKAQ
QEPPVKKGRRSRRCGQCPGCQVPDDCGICTNCLDKPKFGGRNIKKQCCKMRKCQNLQWMP
SKAYLQKQAKAAKKKERKCKVTEKKELPPVKSPSELIVKPVSAPGTSSPPVQEEPATPSL
PQKKNEPPKKQTEEKSEEQIPAASTSETKQSPNSRKTTKQPPSQPSTTIAMTPLTATPST
KKEAPKPIPPESRKKQPPVLPDNTSTEQNKQKKLAMRLGALLKSKGKEKDKPQPPSKPEV
SFNLLNTLCNGGITKQKPPSDGVHRIRVDFKHDCEVENVWDMGGISLLTTAPVTPRVVCF
LCASSGHVEFVYCQVCCEPFHRFCLEERERPSEDQIENWCCRHCKFCHVCGRQQQATKQL
LECNKCRNSYHPECLGPNYPTKPTKKKRVWICTKCVRCKSCGSTTPGKGWDAQWSHDFSL
CHDCAKLFAKGNFCPLCNKCYDDDDYESKMMQCGKCDRWVHSKCENLTDEMYEILSNLPE
SVAYTCINCTERHPAEWRMALTNELQASLRYVLTALLNSRTSSHLLRCRQAAKPPDLNPE
PDENMPSRSSAEGPDPPILTQVGKQDEQPPLDLEGVKRKMDHGKYKSVLEMSDDIVRIIQ
AAMNADGGQPELKKANSMVKSFFTRQMERVFPWFSVKKSRFWEPNKVTSNSSMLPNAVLP
PSLDHNYAQWQERENRLAMQPVLMKKIIPAPKPRSPGDPESPQPVQPSTPPAPTTELNRE
ESPELPPPPGLEDNRQCALCLKYGDDNANHKKQLVYLNEKNLTKNHLSKWNGFPLCNCRT
QMEYVFPSALKYMQIRCELCLKLGATVGCCLTSCTSNYHFMCSRKKNCVFLEDKKVYCQK
HKDLIKGEIVSDNGFEVLRRVFVDFEGITLRRKFLNGLEPDNIHIMIGSMTIDCLGILSD
LSDCEQKLFPIGYQCSRVYWSTTDARKRCVYTCKILECRPPPADPDINSTVQHEENRTIA
HSPQSLHSDVQENKAGECISPRTRETQPHRASDTACYYNTSQKLPRKKTRTHIPRYSPSQ
RSPGSRPLPSAGSPSPVTHEIVTVGDPLLSSGLRKIGSRRHSSSSLSPQQHKKIFSPHPQ
TDISRFGQPLQGIPVNSLENSGNGDPVCIGASTISSKSSCSPNTGQKAIECKLEKAPEAR
RTGFLETPSKVSTPKTEKVKTASPRVSDPSSEHPSPKVPSQVQEMTADASKNKAGCLKDS
SPALLNFKTSSNMQHQKVIRRDNDRQSVVTQGETPSLEKGKNSQILASNHGISVHKDRRV
KTKRSMLDNSKDKHSSKPPSDNEHAPDNRQNEPDTNGNHMLSDTLSFRAHLLKKSIDNGI
SSPGNSQSEETLVSAGKLPQTKMGIDGGCNIEIAKQTTSSANQSAELADNEKHKCVSDGT
GDVPVSQTNSNADSEPQTGSAYPIQESSLVHQDGSKTQEDGSYKRRYPRRSARARSNMFF
GLTPLYGVRSYGEEDLPFCSSTPGKKRGKRAAEGQVDGADDISTSDDDDVYYYNFSRTVV
TPGDERLGIHTLFRQDDQRDLHKIPQLDGVDDEAECNTSVTVTKSSQAGKRSGKQNGAGK
LQTPEGQLEKSHVGKGQKTSEPKIENCHAVKQDTLEAQLALDTPRRAHSGSEKNLLDTFN
SDLLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLTLGDGLGLDN
NRGKEMGLFEVFSQQLPTSEPVDGAVPTTISGEEQFELPLELPSDLSVLTTRSPALPSQN
HSRLGAITTSSDTVEKRVTVTEKSGTPGDGDSSLLGQNLDRASEGHITPDRFITGHIDQE
HISSPTCGQVDHTGREERARNSSTPNLQVSVSPSVSIQNQKYIPSSSESPGTSQIPSNTI
QSTPQHLKSPAEKLVVVNQNMQPLYVLQTLPNGVTQKIQLAPSVPTSSSRTEGEVPVLSP
MGGGLTLATALNPTLTSTFPSASKGILPMSHHPHLQPFPGGPQTTFLPNLNNQSSGLLIG
VQPSSEPSLLVSETGQRSDVGSTSNTSAPGMNKKRQITRLHTRKNKKLAPSVSPASRHAP
DVVSNMTLINFAPSQITGALTSHTGLIDLGTIGNTAPHRNIPSIIKTSKSGVMYFDQTPL
LPQNVGTSSSMGTAPSVIGLDTGHLPGQVTSLATGSPVLNVVSMQPASAAPPVSGHVTLT
SPGILNPSELNSISNFLIKTSPQGLGIQDNHVTLPSGPGMFSQCSTSATIATTSSICVVP
SSQSVGMTLSQPINDPDCHYPISHHMNRLLNSRPQILPESSSETNARAPALQMLAESETK
LTVPTSALGLQRNPVAVPQKTKSKAKRQTAPADKTSRKKQKTLHLAPNPPTVQESERHDK
PAASDHTGAHEEKVNTSELMVPSMKNTAEPPLPAGQLAIISDPEPLLKELCQQDPKHDDS
KQREEDTGFSSPLMRLLQQERNRQGSPTEEKPKTGLLFEISSDDGFQISAGSIEEAWKSL
TEKVQEARSNARLKQLSFAGVSGLRMLGIVHDAVVFLVEQLYGANRCRNYKFRFHRPEGE
EEPPINPHGSARAEVHRRKSAFDMFNFLASKHRQPPEYKPNDEEEEEVQLKSARRATSMD
LPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCRRNIDAGEMVIEYSGNVIRSILTDKREK
YYDGKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVIPIDGQKHIVIFAMRK
IYRGEELTYDYKFPIEDANNKLACNCGTKKCRKFLN
Download sequence
Identical sequences F6Z1Z0
ENSXETP00000022290 ENSXETP00000022279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]