SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6Z3I9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6Z3I9
Domain Number 1 Region: 166-362
Classification Level Classification E-value
Superfamily E set domains 1.12e-73
Family Cytoplasmic domain of inward rectifier potassium channel 0.000002
Further Details:      
 
Domain Number 2 Region: 49-181
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.16e-22
Family Voltage-gated potassium channels 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6Z3I9
Sequence length 424
Comment (tr|F6Z3I9|F6Z3I9_HORSE) Potassium voltage-gated channel subfamily J member 8 {ECO:0000313|Ensembl:ENSECAP00000014532} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=KCNJ8 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MLARKSIIPEEYVLARIAAENLRKPRIRDRLPKARFIAKSGACNLAHKNIREQGRFLQDI
FTTLVDLKWRHTLVIFTMSFLCSWLLFAIMWWLVAFAHGDIYAYMEKSGMEKSGLESTVC
VTNVRSFTSAFLFSIEVQVTIGFGGRMMTEECPLAITVLILQNIVGLIINAVMLGCIFMK
TAQAHRRAETLIFSRHAVIAVRNGKLCFMFRVGDLRKSMIISASVRIQVVKKTTTPEGEV
VPIHQLDIPVDNPIESNNIFLVAPLIICHVIDKRSPLYDISASDLANQDLEVIVILEGVV
ETTGITTQARTSYIAEEIQWGHRFVSIVTEEEGVYSVDYSKFGNTVKVAAPRCSARELDE
KPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLIVPKVQFMTPEGNQN
TSES
Download sequence
Identical sequences F6Z3I9
XP_001502279.1.31192 XP_008524459.1.77740 XP_014687939.1.49734 ENSECAP00000014532 ENSECAP00000014532 9796.ENSECAP00000014532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]