SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6Z550 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6Z550
Domain Number 1 Region: 282-526
Classification Level Classification E-value
Superfamily SIS domain 0.00000000000000512
Family mono-SIS domain 0.017
Further Details:      
 
Domain Number 2 Region: 29-183
Classification Level Classification E-value
Superfamily SIS domain 0.000000717
Family mono-SIS domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6Z550
Sequence length 623
Comment (tr|F6Z550|F6Z550_MONDO) Glucokinase regulator {ECO:0000313|Ensembl:ENSMODP00000019482} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=GCKR OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MPGTKRFQHVIETPEPGKWELSEYEASLPITEKSNPLTKDLDKANAEQIVQLLGQCDAEI
FQEEGSAMPAYQGDRLESTSPIISLIKPCDQSTETLNDPEGGLVVLSGGGTSGRMAFLMS
VSFNQLMKGLGQKPLYTYLIAGGDRSVVASREGTEDSALHGIEELKKVAAGKKRVIVIGI
SVGLSAPFVAGQMDFCMSNPDIFLPVLVGFNPINMARNDPIEDWNSTFREIAEKMQKLQE
KQKAFVLNPAIGPEGLSGSSRMKGGSATKVLLETLLLAAHKTVDRGIAASQSCLLEILRT
FERAHKVTYSQGTKIAALMKQASTRLLSKGRVYLVGWQTLGIIAIMDGLTFKTYFQDVRG
FLIGDHSDMFNRKEELIDQGPQFSFSQEDFLSSILPSLTEIDTVLFIFTLDDNLTEVETL
VEQVKKKTPNIQALAHSTVGQYLPSPLKKLFPSIISITWPLLFFEYEGNFIQKFQRELST
KWVLNTVSTGAHVLRGKILYNHMLDLRLRNSKLFWRGLAMLQRFSGQPKAQCIKSLLKAI
HFPQEVSEEIQAAPISYHIQVAHEKEQVIPTALLTLLFRCSIPEAKTHLTASPSVCETIK
NILLRLGRKRSADSIDTLKMTIE
Download sequence
Identical sequences F6Z550
ENSMODP00000019482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]