SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6Z5G9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6Z5G9
Domain Number 1 Region: 52-333
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 1.57e-82
Family Creatinase/aminopeptidase 0.00000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6Z5G9
Sequence length 335
Comment (tr|F6Z5G9|F6Z5G9_HORSE) Methionine aminopeptidase {ECO:0000256|RuleBase:RU003653} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=METAP1D OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MAAPSGVHRLVLRGCHRILSLPLNHIYLHKQSSSQQRRNFFFRRQREISHSIVLPAAVSS
AHPVPKHIKKPDYVTTGIVPDWGDSIEVKNEDQIQGLRQACQLARHVLLLAGKSLKVDMT
TEEIDALVHQEIISHDAYPSPLGYGGFPKSVCTSVNNVLCHGIPDSRPLQDGDIINIDVT
VYYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISRITHQ
NGLQVCPHFVGHGIGSYFHGHPEIWHHANDSDLLMEEGMAFTIEPIITEGSPEFKVLRMR
GTAVSLDNQRSAQFEHTILITSGGAQILTQLPHEA
Download sequence
Identical sequences F6Z5G9
9796.ENSECAP00000019136 XP_001917093.1.31192 ENSECAP00000019136 ENSECAP00000019136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]