SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6Z6F5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6Z6F5
Domain Number 1 Region: 16-106
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 1.31e-26
Family Cytochrome b5 0.0016
Further Details:      
 
Weak hits

Sequence:  F6Z6F5
Domain Number - Region: 348-408
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0311
Family Calponin-homology domain, CH-domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6Z6F5
Sequence length 423
Comment (tr|F6Z6F5|F6Z6F5_XENTR) Fatty acid desaturase 1 {ECO:0000313|Ensembl:ENSXETP00000061474} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN= OC=Silurana.
Sequence
QGGGGGILEGTAMGSTKELTCYTWEEVKKRCTREERWLVINRKVYDITRFVNIHPGGPRV
ISHYAGQDATDPFVAFHIDQELVKKRMCCLLIGELAPGEPSIEPFKDAAMVEDFRALRTT
VEQMGLFHPSKLFFFVTLLHVLLLDVLAYVTMYYGGTSLISLLVTALLLATVQAQAGWLQ
HDFGHLSVFSRSSWNHVVHQFVIGHLKDLSINKNNHFKLYRLLPLLQKVPIHTYIALSRF
PPQLGMKKKKYMPYNHQHKYFFFIGPPALIPVYFQWYIFYFAIRRKKWADLAWMISFYVR
FGLCYIPFLGVSGTIALFMVVRFIESNWFVWVTQMNHIPMNIDYDQNKEWLSTQLQATCN
VDQSLFNDWFSGHLNFQIEHHLFPTMPRHNYWKAAPLVRSLCKKYGIEYQSKPLFTAFAD
IVQ
Download sequence
Identical sequences F6Z6F5
ENSXETP00000061474 ENSXETP00000061474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]