SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6Z6V3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6Z6V3
Domain Number 1 Region: 234-410
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.06e-25
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 520-635
Classification Level Classification E-value
Superfamily Second domain of FERM 7.46e-16
Family Second domain of FERM 0.0018
Further Details:      
 
Weak hits

Sequence:  F6Z6V3
Domain Number - Region: 422-512
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0641
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6Z6V3
Sequence length 735
Comment (tr|F6Z6V3|F6Z6V3_HORSE) KRIT1, ankyrin repeat containing {ECO:0000313|Ensembl:ENSECAP00000014886} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=KRIT1 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MGNPENTEDAYVAVIRPKNTASLNSREYRAKSYEILLHEVPIEGQKKKRKKVLLETKLQG
SSEITQGILDYVVETTKPISPANQGIRGKRVVLMKKFPLDGEKMGREAALFIVPSVVKDN
TKYTYTPGCPIFYCLQDIMRVCSESSTHFATLTARMLIALDKWLDERHAQSHFIPALFRP
SPLERIKTNVINPAYATESGQTENSLHMGYSALEIKSKMLALEKADTCIYNPLFGSDLQY
TNRVDKVVINPYFGLGAPDYSKIQIPKQEKWQRSMSSVTEDKERQWVDDFPLHRSACEGD
SELLSRLLNERFSVNQLDSDHWAPIHYACWYGKVEATRILLEKGKCNPNLLNGQLSSPLH
FAAGGGHAEIVQILLNHPEVDRHITDQQGRSPLNICEENKQNNWEEAAKLLKEAINKPYE
KVRIYRMDGSYRSVELKHGNNTTVQQIMEGMRLSQETQQYFTIWICSENLSLQLKPYHKP
LQHVRDWPEILAELTNLDPQRETPQLFLRRDVRLPLEVEKKIEDPLAILILFDEARYNLL
KGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIVPVTKLKSKAPHWTNR
ILHEYKNLSTSEGVSKEMHHLQRMFLQNCWEIPTYGAAFFTGQIFTKASPSNHKVIPVYV
GVNIKGLHLLNMETKALLLSLKYGCFMWQLGDADTCFQIHSMENKMSFIVHTKQAGLVIK
LLIKLNGQLMPERNS
Download sequence
Identical sequences F6Z6V3
ENSECAP00000014886 9796.ENSECAP00000014886 ENSECAP00000014886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]