SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6Z7V2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6Z7V2
Domain Number 1 Region: 138-315
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-58
Family SPRY domain 0.00000248
Further Details:      
 
Domain Number 2 Region: 49-123
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000111
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6Z7V2
Sequence length 332
Comment (tr|F6Z7V2|F6Z7V2_CALJA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCJAP00000028177} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN= OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
LKGVAGCDHGGWGNLANKRPHTPLPHRPRFRCQTMASEGAVGRRVSTDELLKEATRCPIC
TAYLEKPMTLECECVFCLSCTNSLQKEPQGEGVLCPFCLVASQKNNIRLNRQLGSLVSHI
KELEPKLKKILQMNPKIRKFQAVEVTLDVDTAHNLLLISEDLRSVHCGRIHQNRPDLAER
FNLAGAVLGSPGFTSGRHYWEVDLGTSEEWNLGVCRESASRKGIIQMTTDHGFWIVSLRA
GGFHFANTSPPTPLWVNPDLQRVGIFMDRGMGDISFYHLGDGSHIYTFTKVFPEEPLRPY
FAPSTLPDQGVLSICPVTNPGTAHPVLPGEGK
Download sequence
Identical sequences F6Z7V2
ENSCJAP00000028177 ENSCJAP00000028177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]