SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6ZAR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6ZAR4
Domain Number 1 Region: 24-163
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.89e-25
Family Calponin-homology domain, CH-domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6ZAR4
Sequence length 376
Comment (tr|F6ZAR4|F6ZAR4_XENTR) LIM and calponin homology domains 1 {ECO:0000313|Ensembl:ENSXETP00000045573} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=limch1 OC=Silurana.
Sequence
MASSATLQGEEIPPPQESPPDTACREAQKWIEQVTGKSFGDKDFRTGLENGILLCELLNA
IKPGLVKKINRLPTPIAGLDNITLFLRGCKELGLKESQLFDPGDLQDTANRTTARNSDCN
RKLRNVLITVYWLGKAASSCSSYSGNNLDLKEFEGLLAQMRKENEEIESPKRSIRDSGYI
DCWDSERSDSLSPPRHGRDDSFDSLDSFGSRSQQTPSPDVVLRGSSDGRGSDSESDLPHR
RLPDVRKDDMSARRVSYGENKAFVPFNQYLPNKSNQTSYIPAPLRKKKAEREDYRKSWST
ATSPLGGERPFRSMSMCDMRYEEEGSMQPHSRAHYEHLQHVNSLLKEEDDTWQDDLAKWK
TRRRSASQDLIKKEEQ
Download sequence
Identical sequences F6ZAR4
ENSXETP00000045573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]