SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6ZC04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6ZC04
Domain Number 1 Region: 236-345
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.18e-22
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000307
Further Details:      
 
Domain Number 2 Region: 29-83
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000117
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00097
Further Details:      
 
Domain Number 3 Region: 404-457
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000118
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6ZC04
Sequence length 457
Comment (tr|F6ZC04|F6ZC04_XENTR) Wiskott-Aldrich syndrome {ECO:0000313|Ensembl:ENSXETP00000026113} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=was OC=Silurana.
Sequence
MSRGGPKAAVRQQDNVSSSLLLPQENQKVFQLLGRKCTTLATTVVQLLVVQGGDRWAKQF
LGVLCLVKDNPRRSYYFQLFDLQVSTRAPYRAEKLTIKAPVLLLFYSLSFYRVGLRVALQ
VPPPATSPNPPTAGAHKFTAWVEGAPARVGSGPPAPTRTVAQSDPSPQARGLSHVSSGPS
SPQPLAPSQSLNMPAVSIPNPDIISARYRALSAPADKGKNKKGKKKFSKADIGAPSGFKH
VSHVGWDPNRGFDVNQLDPDIRNLFSRAGISDAQLKDAETSKLIYDFIEQQGGVEAVKNE
MRRGETAPPPPPPSRNAPPAPTPSRGRTGPLPPPPVRGSSAPPPPPPSRSTPPIPPPTAR
SGGPPPPPPPPPSIPAPPPTSGPAPPPPPPVSGTQSIPSPTPSGGRGALLDQIRQGTKLN
KLTVSAEPPPSPQPSSEGLVGALMHVMQKRSKAIHSS
Download sequence
Identical sequences F6ZC04
ENSXETP00000026113 ENSXETP00000026113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]