SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6ZDD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6ZDD1
Domain Number 1 Region: 113-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000117
Family Cripto EGF-like domain-like 0.00041
Further Details:      
 
Domain Number 2 Region: 78-111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000298
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6ZDD1
Sequence length 188
Comment (tr|F6ZDD1|F6ZDD1_HORSE) Uncharacterized protein {ECO:0000313|Ensembl:ENSECAP00000016808} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=TDGF1 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
VDRRKMERFSCSVIMVMAISTAFELGLVAGLGHHELARPSQGDLAFRADTVRSQEEPAVR
RRQPFQFVPSTGIQDSKELNKTCCLNGGTCMLGSFCACPPSFYGRNCEHDLRKENCGSVP
HGTWLPRRCSMCKCWHGQLRCFPQAFLPGCDGHVMDEHLAASRTPELILSACTTLTLAGI
CLAIQSYC
Download sequence
Identical sequences F6ZDD1
9796.ENSECAP00000016808 ENSECAP00000016808 ENSECAP00000016808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]