SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6ZFP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6ZFP5
Domain Number 1 Region: 215-278
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000236
Family SH3-domain 0.0015
Further Details:      
 
Domain Number 2 Region: 618-730
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000249
Family Second domain of FERM 0.01
Further Details:      
 
Weak hits

Sequence:  F6ZFP5
Domain Number - Region: 731-815
Classification Level Classification E-value
Superfamily PH domain-like 0.00676
Family Third domain of FERM 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6ZFP5
Sequence length 823
Comment (tr|F6ZFP5|F6ZFP5_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000032397} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MIPSAGPVPSMGDEYISTQLLPPSSSVSFSYASASWRLFLRKEVFYPRENFSHPYCLQLL
CEQILRDTFTESCTQISPEERSKMKDMLVDLKVGMDASSITEDSIKKRIVVAARDNWANY
FSRIFRVSGESGSDVQLLAVSHRGLRLLKVVNDATVHTGHLKTLCSYSFAEVLDVKAQEH
GVLQLSLRNEQLILHTSQAQAIKSMVELFLNELKKDSSYVIALRSYVTDNPSLLSFHYGD
IIKLLPMSSLEPGWQFGSIGGRSGLFPSDMVKVAAASDYLTMPMERKVEGHRNSRRESGL
SPQKQAMECEHPPSQAPSEYSGLTSSVFLDVDSTLAASISTYTMWEYALHHFRPIQTSEG
WMLDMAEHSARSLVQHTKIPIQKSLTNLTDEDMNNLAVANFMAVMQFMGDQPKKKDELDI
PYEMMKLCRDNNLKDEIYCQIIKQVTENPNQEHCIRGWYLLSLLTGYFLPSPTLMPYVIK
FLKDATLYQELAQKCQGHLQQTVKYGGRRHLPTIGEMQAFLKGQTVRSLLLHLPGGIEYK
TIIQTFTVTAEVLEEMCSQMGIREPLEVQEFAIFLIKKEETIAWDQLGVLVRPLHPNEYL
NNVTREPNVELHSRRITWDTPLHYENEIYLSTHYSQLHRDYLQGKLLVSTHSQVEALLAP
LTALQHLTRKTSDLPSEQDLLRYVPHPLQQQVNLRVLRNLMENQLKSLKRYSCREAQVNF
IEMVKSLPLFGYTIYTVLRLSEPEIATPCLLGLNRQHLILVDPRTQEQCYSIALKDIQHL
RQLSPLDGAPAMELNYGSFANPKTIWFESPQAQELRYTLIFLM
Download sequence
Identical sequences F6ZFP5
ENSMODP00000032397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]