SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6ZGE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6ZGE5
Domain Number 1 Region: 113-216
Classification Level Classification E-value
Superfamily Fibronectin type III 5.9e-18
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 2 Region: 217-312
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000108
Family Fibronectin type III 0.00011
Further Details:      
 
Domain Number 3 Region: 32-135
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000964
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6ZGE5
Sequence length 470
Comment (tr|F6ZGE5|F6ZGE5_MONDO) Interleukin 11 receptor subunit alpha {ECO:0000313|Ensembl:ENSMODP00000009813} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=IL11RA OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MSNGCSGLGRVLVTVAAALVSVSTTDSESWGPPGVQYGQLGETIVLLCPGVAPGTLVSWH
RAEGHALLETSRSELGLGQQELVLERVDSQDEGTYICQSQDGDTRGSVTLQLGHPPSRPM
VSCRASDYENFSCSWSPSRVSGLPTRYITSYRKKIILGTERGRPALSAEPRPCLPELPGA
TRCVVHGSEFWSQYRINVTEVNPLGASARLLDVSMQSILRPDPPQGLRVEPVPGAPRRLL
VRWAYPNSWPLQPHFLLKFRLQYRPVRHLTWSMVEPSGLEEVITDAVAGLPHAVRVSARD
FLDAGTWSDWSEEAWGTPSPVLVTSGPSTRPIERPAETETQTQVHTKVQAQTEMKPERHV
LPEPSLQPDSQPLMDHRDPLEQVAVVTSLGVFSFVGLAAGALVLLLWLRLRGNRKGAAPK
PGFLAPMVQVKTMPAFWSGFIVTCGIRGGSGDWEEDSEDHSCDQTMAQIL
Download sequence
Identical sequences F6ZGE5
XP_007498913.1.35504 ENSMODP00000009813 ENSMODP00000009813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]