SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6ZIS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6ZIS3
Domain Number 1 Region: 9-145
Classification Level Classification E-value
Superfamily NTF2-like 1.17e-35
Family NTF2-like 0.0033
Further Details:      
 
Domain Number 2 Region: 336-447
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.21e-19
Family Canonical RBD 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6ZIS3
Sequence length 491
Comment (tr|F6ZIS3|F6ZIS3_MONDO) G3BP stress granule assembly factor 2 {ECO:0000313|Ensembl:ENSMODP00000023979} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=G3BP2 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MHLTLRSKEMVMEKPSPLLVGREFVRQYYTLLNKAPEYLHRFYGRNSSYVHGGVDASGKP
QEAVYGQNDIHHKVLSLKFSECHTKIRHVDAHATLSDGVVVQVMGLLSNSGQPDRKFMQT
FVLAPEGSVPNKFYVHNDMFRYEDEVFCDSEPELDEESEEEVEEEQEERQPSPEPVQESA
NSAYYETHPVTNGIEEPLEESSHDPEPEPESETKTEELKPPVEEKNLEELEEKSASPPPA
EPVSLPQEPPKAFSWASVTSKNLPPSGTVSSSGIPPHVKAPVSQPRIETKSEAQSQPPRV
REQRPRERPGFPPRGPRPGRGDMEQNESDNRRIIRYPDSHQLFVGNLPHDIDENELKEFF
MSFGNVVELRINTKGVGGKLPNFGFVVFDDSEPVQRILVAKPIMFRGEVRLNVEEKKTRA
ARERETRGGGDDRRDLRRNDRGPGGPRGIVGGGMMRDRDGRGPPPRGGMAQKLGSGRGAG
QMEGRFTGQRR
Download sequence
Identical sequences F6ZIS3
ENSMODP00000023979 ENSMODP00000023979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]