SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6ZN91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6ZN91
Domain Number 1 Region: 64-121
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000018
Family ATI-like 0.047
Further Details:      
 
Domain Number 2 Region: 224-300
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000314
Family VWC domain 0.027
Further Details:      
 
Weak hits

Sequence:  F6ZN91
Domain Number - Region: 132-159
Classification Level Classification E-value
Superfamily PMP inhibitors 0.00549
Family PMP inhibitors 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6ZN91
Sequence length 483
Comment (tr|F6ZN91|F6ZN91_MACMU) Uncharacterized protein {ECO:0000313|EMBL:EHH22553.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_05843 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
LRSLFAQCHALVPPQHYYDACVFDSCFVPGSSLECASLQAYAALCAQQGVCLDWRNHTHG
ACLVECPSHREYQACGPAEEPTCKSSSSQQNNTVLVEGCFCPEGTMNYAPGFDVCVKTCG
CVGPDNVPREFGEHFEFDCKNCVCLEGGSGIVCQTKRCSQKPVTHCVEDGTYLATEVNPA
DTCCNITVCKCNTSLCKEKPPECPLGFEAKSKMVPGRCCPFYWCESKGVCVHENAEYQPG
SPVYSSKCQDCVCTDKVDNSTLLNTITCTHVPCSTSCSPGFELVEAPGECCKKCEQTHCI
LKQPDNQHVILKPGDFKSDPKNNCTFFSCVKIHNQLISSISNITCPNFDASICVPGSITL
MPNGCCKTCIPRNETRVPCSTVPVITEVSYAGCTKTVLMNHCSGSCGTFAMYSARAQSLD
HGCSCCREEKTSQREVVLSCPNGGSLAHTYTHIESCQCQDTICELPTDTSRRARRSPRHL
GSG
Download sequence
Identical sequences F6ZN91
ENSMMUP00000005256 9544.ENSMMUP00000005256 ENSMMUP00000005256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]