SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6ZQI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6ZQI7
Domain Number 1 Region: 18-191
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.67e-51
Family DBL homology domain (DH-domain) 0.0000353
Further Details:      
 
Domain Number 2 Region: 177-326
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-34
Family Pleckstrin-homology domain (PH domain) 0.00061
Further Details:      
 
Domain Number 3 Region: 341-455
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.03e-25
Family DEP domain 0.004
Further Details:      
 
Domain Number 4 Region: 438-529
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.29e-21
Family DEP domain 0.0019
Further Details:      
 
Domain Number 5 Region: 566-641
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000413
Family PDZ domain 0.023
Further Details:      
 
Domain Number 6 Region: 645-709
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000399
Family PDZ domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6ZQI7
Sequence length 1594
Comment (tr|F6ZQI7|F6ZQI7_CALJA) Phosphatidylinositol-3,4,5-trisphosphate dependent Rac exchange factor 1 {ECO:0000313|Ensembl:ENSCJAP00000030476} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=PREX1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
LLQAFLHRIRQNVADSVEKGLTEENVKILFSNIEDILEVHKDFLAALEYCLHPEPQSQHE
LGNVFLKFKDKFYVYEEYCSNHEKALRLLVELNKIPTVRAFLLSCMLLGGRKTTDIPLEG
YLLSPIQRICKYPLLLKELAKRTPGKHPDHPAVQSALQAMKTVCSNINETKRQMEKLEAL
EQLQSHIEGWEGSNLTDICTQLLLQGTLLKISAGNIQERAFFLFDNLLVYCKRKSRVTGS
KKSTKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHSNGYTVTNGWKIHNTAKNKWF
VCMAKTAEEKQKWLDAIIREREQRESERLKLGMERDYVMIAEKGEKLYHMMMNKKVNLIK
DRRRKLSTVPKCFLGNEFVAWLLEIGEISKTEEGVNLGQALLENGIIHHVSDKQQFKNEQ
VMYRFGMTMVRTRARSELEDIMSKGVRLYCRLHSLYTPVIKDRDYHLKTYKSVLPGSKLV
DWLLAQGDCQTREEAVALGVGLCNNGFMHHGLAAGEEIEFRDESQYFRSTLMRRTVGTAV
PKREKRRGINPLISSIFLPSRALILPQEEDYGFDIEEKNKAVVVKSVQRGSLAEMAGLQV
GRKIYSINEDLVFLRPFSEVESILNQSFCSRRPLRLLVATKAKEIIKIPDQPDTLCFQIR
GAAPPYVYAVGRGSEAMAAGLCPGQCVLKVNGSSVMNDATPEVLEHFQAFRSRREEALGL
YQWIYHTHEDAQEARATQEAPSEDPSGERAQEEDQTESAFPLLSLGPRLSLCEDSPVVSL
TVDNVHLEHGVVYEYVSTAGVRCHVLEKIVEPRGCFGLTAKILEAFAADDSIFVENCARL
MALSSAMVTMPHFEFRNICDTKLESIGQRIACYQEFAAQLKSRVSPPFKQATLEPHPLCG
LDFCPTNCHINLMEVSYPKTTPSVGRSFSIRFGRKPSLIGLDPEQGHLNPMSYTQHCVTT
MAAPSWKCLPVAESDPQGKGLHDSSFVGQEDQGLSFLLKQEDREIQDAYLQLFTKLDVAL
KEMKQYVTQINRLLSTITEPTSGGSCDPSLAEEASSLPLVSEENEMDRSDHGGIKKVCFK
VAEEDQEDSGHDTMSYRDSYSECNSNRDSVLSYTSVRSNSSYLGSDEMGSGDELPCDMRI
PSDKQDKLHGCLEHLFNQVDSINALLKGPVMSRAFEETKHFPMNHSLQEFKQKEECTIRG
RSLIQISIQEDPWNLPNSIKTLVDNIQRYVEDGKNQLLLALLKCTDTELQLRRDAIFCQA
LVAAVCTFSEQLLAALGYRMHNLGPREEAGNTQSSPSSSHWGVWAQAREAVTLLGPVSEK
EERTMLEDIWVTLSELDNVTFSFKQLDENYVANTNVFYHIEGSRQVLRVVFYLDSYHFSK
LPSRLEGGGSLRLHTVLFTKALENVEGLPSPGSQAADDLQQEINVQSLEKVQQYYRKVRA
FYLERSNLPTDASTTAVKIDQLIRPINALDELCRLMKSFVHSKPGTAGSVGAGLIPISSE
LCYRLGACQMVMCGTGMQSHCRSTLSVSLEQAAILARSHGLPKCIMQATDIMRKQGPRVE
ILAKNLRVKDQMPQGAPRQLQKWKLNSRPVMPDS
Download sequence
Identical sequences F6ZQI7
ENSCJAP00000030476 ENSCJAP00000030441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]