SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6ZU67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6ZU67
Domain Number 1 Region: 1654-1753
Classification Level Classification E-value
Superfamily Plakin repeat 7.59e-19
Family Plakin repeat 0.0069
Further Details:      
 
Domain Number 2 Region: 268-393,581-611
Classification Level Classification E-value
Superfamily Spectrin repeat 4.47e-16
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 3 Region: 141-212
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000118
Family Spectrin repeat 0.0077
Further Details:      
 
Weak hits

Sequence:  F6ZU67
Domain Number - Region: 570-701
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000561
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6ZU67
Sequence length 1754
Comment (tr|F6ZU67|F6ZU67_MONDO) Periplakin {ECO:0000313|Ensembl:ENSMODP00000007487} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=PPL OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MTSLFRKRNKGKYSPTVQTKSISSKELSELIDQLQKNADQVERNIVDTDSKMQSDLAKIK
EGQPAQHREHSLQKLAESEKLLYVLEGDAAIAKHMKHPQGDMIAEDIRQLKERVANLRMK
HHQIYNLTVKEVDPQVNWSSVVDEKLDMLGNQNFGTDLPLVDHQVEEHNIFHNEVKAIGP
HITKEGDKEQNSDLQAKYQKLLAGSQARQQHLSSLQDYMQRCTNELYWLDQQAKGRMQYD
WSDRNLDYPSRRRQYENFINRNLEAKEERINKLHSEGDLLLAAEHPGRNSIEAHMEAVHA
DWKEYLNLLICEESHLKYMEDYHQFHKDVKDAQELLRKVDTDLNQKYSPEFKDRYQIESL
LRELDDQEKALDKYDDVIRSLQKRGQQVVPLKYRRETPLKPIPVEALCDFENEQGLISRG
YSYTLQKNNGENWDITDSSGNKLNAPAVCFMIPPTDPEALALTDSLSNQYRSVKQKAAGS
KVALKQRYEILKTENPGDASDLQGRQLLASLDKVNSDLERQEKAITAILRPPLEQSRAVQ
DSAERAKDLKNITNELRRIEPEKIQSTEECDAFIGALPDSGSAPLLKTRVEDTNHKYDRL
FQLLNSAQEKVDGANRLENSLQQGRELLSKYENQLSLDDTVPENEQSLDNKRQELTAIAS
ELQAKRSLLSEADQNLQRTKKCSSTLASRFQEHCADIERQEAEVNKLNQRFDNLIKQINN
RSQSLQKAKGAYSDYRSGYDHVTQFLANIPSYEPQETDSLSQVETKLKNQKNLLDEIGGW
EQEVQKVYNHAQQYQQAVKDYELEAEKLRSLLDLENGRNVHTNKRARLQSPAAKVKEEET
FLAAKFTEVNAINRQRLQNLEFAQNLLRQQPEIEVTHESTQGKEPVTEETWRIKKALDDE
TQRRQQLENEVKSTQDEIIILKNKKPQESVIRKEVLKKVPDPALEESLHRMQQTLVEEQR
KNKELQDELEDMKLKLRSLEHETRDGGQEYVVKEVLRIEQDKAQADEVLKLREELEELRR
QKGTRETEVILLQQRIAALSEEKNKELEKVTEKEVVKLQNDPQLEKEYRLLQEQQQNEST
QREKQEEELSFLQDKLKRLEKERAMAEGKITVKEVLKVEKDAAIEREVNDLKRQYEDEAS
KSRSSQREKTELLRKIWALEEENSKVIVQEKVREIVRPDPKAESEVANLRLELVEQERKY
RGTEEQLKSYKSELEALRKRGPQIEVKEVTKEVIKYKTDPETEKELQRLREEIVDKTRLI
ERCDLEIYQLKQEIQSLKDTKPQVQTKEVVQEILQFREDPKTKEEVETLRIKLSEEQKRQ
VDLERERLSQEDKIKQKEEELSQVKEKVVEQEVVKYEQDPATRAEVDSFTESIDIELRQI
DNLRGELRKLQRRRAELEHQLEELERERQARREAELEVQRLKLRLADLEKEEGETKEKVT
RKQKVVLQQDPQQAKEHSLLKLQLEEEKHRRQILESELEALKKKLLTLEKMEVKEKVVFS
ESVQVEKGDTEQEIQKLKNSLEEESRIKRELDAEVSRLEAKLSELEFHNSKSSKELDFLR
EENHKLHLEKQNLQMETRRLQSEIEMTTTETRDLRNMTSVDCGANLDSRLWSLERELDDL
KRISRDKDNEIDELHKRLGSVAIKREQRENHLRRSIVVIDPDTGRELSPEEAHRAGLIDW
NMFVKLRSQECDWEEISVKGPNGESSVIHDRKSGKKFSIEDALKNGRLTPAQYDRYVNKD
MSIQELAVLVSGRK
Download sequence
Identical sequences F6ZU67
ENSMODP00000007487 ENSMODP00000007487 XP_007498778.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]