SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6ZVU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6ZVU1
Domain Number 1 Region: 37-270
Classification Level Classification E-value
Superfamily NHL repeat 2.17e-22
Family NHL repeat 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6ZVU1
Sequence length 280
Comment (tr|F6ZVU1|F6ZVU1_MACMU) NHL repeat containing 3 {ECO:0000313|Ensembl:ENSMMUP00000036384} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=NHLRC3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MARFWVCVAGAGVFLAFLVLHSRFCGSPVLRNFTFAVSWRTEKSLYRLDVDWPKHPEYFT
GTTFCVAVDSLNGLVYIGQRGDNIPKILVFTEDGYFLRAWNYTVDTPHGIFAASTLYEQS
IWITDVGSDFMILWLHGENGTGPAKFNIPHSVTLDSAGRVWVADRGNKRIQVFDKDTGEW
LGAWNNCFTEEGPSSVRFTPDGKYLIVAQLNLSRLSVVAAPPVGSIGECSVISTIQLADQ
VLPHLLEVDRKTGAVYVAEIGAKQVQKYVPLNSYVPAFGS
Download sequence
Identical sequences A0A2K5TUC6 A0A2K6DEG7 F6ZVU1
ENSMMUP00000036384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]