SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6ZYT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6ZYT4
Domain Number 1 Region: 23-187
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 5.26e-31
Family Pentapeptide repeats 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6ZYT4
Sequence length 191
Comment (tr|F6ZYT4|F6ZYT4_CIOIN) uncharacterized protein LOC100177323 {ECO:0000313|RefSeq:XP_002123229.1} KW=Complete proteome; Reference proteome OX=7719 OS=Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis). GN=LOC100177323 OC=Phlebobranchia; Cionidae; Ciona.
Sequence
METTKVMFQVVVLMFAVVSQVSTADYSGEDRRGQSFLGVDHSFSKFVGADLRGSNFIGAN
FSFSDFGGSDFRGCDFNGCIFSVSDFGGALFSGSHFRGSDFSFSDFSGSDFSGSEFTGSD
FTHSKYNGADFTGSSFRGSTFASSAFNSSDFSGSEFLGSSFATSEFIDGDFSGSTFVNSE
FTGKNFVKERP
Download sequence
Identical sequences F6ZYT4
ENSCINP00000017659 XP_002123229.1.78797 7719.ENSCINP00000017659 7719.ENSCINP00000028807 ENSCINP00000017659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]