SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6ZZD6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6ZZD6
Domain Number 1 Region: 169-419
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.57e-78
Family Eukaryotic proteases 0.0000378
Further Details:      
 
Domain Number 2 Region: 41-160
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000000157
Family SEA domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6ZZD6
Sequence length 420
Comment (tr|F6ZZD6|F6ZZD6_MONDO) Transmembrane protease serine {ECO:0000256|PIRNR:PIRNR037941} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=TMPRSS11E OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MYRPVVPVRKRSCLEPWVIGLITFISLIVLAVCIGLIVHYVRYNTLKPYNYYSTLSFTSD
KYYHEFDKEATTNFTEMSQRIESIVKSAFYDSILRKQFIKSQVIKFSPQEPGVVAHMLMI
FRFPSTQTPESIKKTIQRVLHEKLQHATGPPQVDPSSVKMVHINKTETDQYLNSCCGTRR
GMSSGTSLRIVGGEEVEQEGEWPWQASLRWNGEHRCGATLINATWLVSAAHCFRNYKDPA
NDCFGVTLRPPKERRGIRRIIVHENYKYPSHEYDIAVLQLDRPVPYTNAVHRVCLPDASY
KVKAGDAAYVTGFGAMRNDGTSVNNLRQVKVNIIDTKICNEPQIYNNDITAGMICAGFLT
GGKDACQGDSGGPLVSPNSREIWYLIGIVSWGDECAQRNKPGVYTLVPFFREWIASKTGV
Download sequence
Identical sequences F6ZZD6
ENSMODP00000025953 ENSMODP00000025953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]