SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7A1R3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7A1R3
Domain Number 1 Region: 2-187
Classification Level Classification E-value
Superfamily YWTD domain 1.15e-28
Family YWTD domain 0.00017
Further Details:      
 
Domain Number 2 Region: 278-319
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 3 Region: 319-358
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 413-449
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 373-408
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 243-280
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0017
Further Details:      
 
Weak hits

Sequence:  F7A1R3
Domain Number - Region: 197-258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0251
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7A1R3
Sequence length 449
Comment (tr|F7A1R3|F7A1R3_HORSE) Uncharacterized protein {ECO:0000313|Ensembl:ENSECAP00000009607} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN= OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
VGSVEGLAYHRAWDTLYWTSSTTSSITRHTVDQTRPGAFDREAVIAMSEDDHPHVLALDE
CQNLMFWTNWNEQHPSIMRATLTGKNAQMVVSTDILTPNGLTIDHRAEKLYFSDGSLGKI
ERCEYDGSQRHVIVKSGPGTFLSLAVYDNYIFWSDWGRRAILRSNKYTGGDTKILRSDIP
HQPMGIIAVANDTNSCELSPCALLNGGCHDLCLLTPNGRVNCSCRGDRILLDDNRCVAKN
SSCNIYSEFECGNGECIDYQLTCDGIPHCKDKSDEKLLYCENRSCRRGFKPCYNHRCIPH
DKLCDGENDCGDNSDELDCKVSTCAAVEFRCADGTCIPRSARCNQNIDCADASDEKNCNN
TDCTHFYKLGVKTTGFIKCNSTSLCVLPTWICDGSNDCGDYSDELKCPVQNKHKCEENYF
GCPSGRCILNTWICDGQKDCEDGLDEFHC
Download sequence
Identical sequences F7A1R3
ENSECAP00000009607 9796.ENSECAP00000009607 ENSECAP00000009607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]