SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7A3E5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7A3E5
Domain Number 1 Region: 6-164
Classification Level Classification E-value
Superfamily PR-1-like 7.06e-53
Family PR-1-like 0.0000455
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7A3E5
Sequence length 241
Comment (tr|F7A3E5|F7A3E5_MONDO) GLI pathogenesis related 1 {ECO:0000313|Ensembl:ENSMODP00000025586} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=GLIPR1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
DTLPKITNEDFIKECVDIHNKLRSSVSPKASNMLKMSWDPDLAKTARAWAKRCEFKHNIY
LDTAKMAHPTFNPVGENMWTGSLGQFTPTVAIQMWYDEVKNYDYQTQKCTGVCGHYTQVV
WANSYKIGCAVQFCPKVKGFGALSNGAHFLCDYGPAGNYPTRPYKKGNACSDCRGEKCVK
KLCENPSRDEVKGTNFHPVWEIFERNRKLSLTLTLGPLFIILFAIVVSLIKHYYPRQVTS
E
Download sequence
Identical sequences F7A3E5
ENSMODP00000025586 ENSMODP00000025586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]