SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7A3Z5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7A3Z5
Domain Number 1 Region: 504-605
Classification Level Classification E-value
Superfamily TIMP-like 6.28e-23
Family Netrin-like domain (NTR/C345C module) 0.035
Further Details:      
 
Domain Number 2 Region: 332-397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000053
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 3 Region: 395-451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000109
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 262-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000157
Family Laminin-type module 0.055
Further Details:      
 
Weak hits

Sequence:  F7A3Z5
Domain Number - Region: 101-163
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0493
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7A3Z5
Sequence length 605
Comment (tr|F7A3Z5|F7A3Z5_MACMU) Netrin 4 {ECO:0000313|Ensembl:ENSMMUP00000000709} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=NTN4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MGSCARLLLLWGCTVVAAGLSGVAGASSRCEKACNPRMGNLALGRKLWADTTCGQNATEL
YCFYSENTDLTCRQPKCDKCNAAHPHLAHLPSAMADSSFRFPRTWWQSAEDVHREKIQLD
LEAEFYFTHLIMVFKSPRPAAMVLDRSQDFGRTWKPYKYFATNCSATFGLEDDVGKKGAI
CTSKYSSPFPCTGGEVIFKALSPPYDTENPYSAKVQEQLKITNLRVQLLKRQSCPCQRND
LNEEPQHFTHYAIYDFIVKGSCFCNGHADQCIPVHGFRPVKAPGTFHMVHGKCMCKHNTA
GSHCQHCAPLYNDRPWEAADGKTGAPNECRTCKCNGHADTCHFDVNVWEASGNRSGGVCD
DCQHNTEGQHCQRCKPGFYRDLRRPFSAPDACKPCSCHPVGSAVLPANSVTFCDPSNGDC
PCKPGVAGRHCDRCMVGYWGFGDYGCRPCDCAGSCDPITGDCSSSNTDIDWYHEVPDFRP
VHNKSEPAWEWEDAQGFSALLHSVLKIKILSAHDKGTHVEVNVKIKKVLKSTKLKIFRGK
RTLYPESWTDRGCTCPILNPGLEYLVAGHEDVRTGKLIVNMKSFVQHWKPSLGRKVMDIL
KRKCK
Download sequence
Identical sequences A0A2K5TJU6 F7A3Z5
ENSMMUP00000000709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]