SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7A409 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7A409
Domain Number 1 Region: 583-764
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-59
Family SPRY domain 0.0000034
Further Details:      
 
Domain Number 2 Region: 3-90
Classification Level Classification E-value
Superfamily DEATH domain 3.77e-21
Family Pyrin domain, PYD 0.0029
Further Details:      
 
Domain Number 3 Region: 382-445
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 9.77e-17
Family B-box zinc-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7A409
Sequence length 767
Comment (tr|F7A409|F7A409_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000020549} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MAKTLSDHLLHTLESLVAYDLEKFKFKLQTANLDKDQVRIPHGRLQNATGPVKLADLLIN
YYGERYAVKLTLQVLQAINQNLLVEELSQAITPECLTQECATEISGISAFSRTTGSKTLE
ITVPLKGILENEDANFQGPNEDIMDGIQVPISSSQLHAGQEYQEDSPETDASLVLESNRY
ENSEGFVTFGKKAYRNQAPLFLSAKRIPNQEFDDFSGEQNHPNQKSMNKEHGNSEVSVSL
GETTILYKDQVPESPKEKIFGNVDTSMLSGEKGTKDPGNWYLKEAHEDEPRLRRIPTEAF
NLLRITGAPCRAASLRRVQESCSICQAMVVNPSKISWGNHIRSHYNVGHNVCLKCQAMFP
KNFQHSRSLENIPTDYRGPKLNPQSMPQCECHPKQLQRLFCKDHGKTICLICSMSPEHRG
HRMLPIEEAAQSYKEQIQNQLEHLKKVRETAEEKKSQGNKTITAFLNKTETQKMQIMSQL
KELHDFLEKQERLFLVWLEELSKTIFRSKEDYITKASQEISLLEELMGELEEKQKQPAWE
FLQSVERSMRQFIGLYIKTWYIEKLETQLSHLIPGSGSKIPYLCFTNVTLDPETAHPKLI
ISDDRKHVRLGKKCGKVFDGPQRFNDSVIVLGYPSFTSGKQYWQVDVGDKTSWILGVCKN
SVNRKGSTAFSPGNGYWLVMMMKKNEYSASTIPPTPLSLKEPPRCVGIFMDFEAGDISFY
NVTARSHIYTFSFSSSSSGPLRPVFSPGIQDRGKNADPLTICSVNRW
Download sequence
Identical sequences F7A409
ENSMODP00000020549 ENSMODP00000020549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]